KEGG   Rattus norvegicus (rat): 81748Help
Entry
81748             CDS       T01003                                 

Gene name
Pls3
Definition
(RefSeq) plastin 3
  KO
K17336  plastin-3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    81748 (Pls3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    81748 (Pls3)
   04147 Exosome [BR:rno04147]
    81748 (Pls3)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    81748 (Pls3)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     81748 (Pls3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   81748 (Pls3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CH EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 CAMSAP_CH EF-hand_8 DUF5580 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 81748
NCBI-ProteinID: NP_112346
RGD: 621409
Ensembl: ENSRNOG00000027520
UniProt: F1LPK7 Q562B2
Position
Xq34
AA seq 630 aa AA seqDB search
MDEMATTQISKDELDELKEAFAKVDLNSNGFICDYELHELFKEANMPLPGYKVREIIQKL
MLDGDRNKDGKISFNEFVYIFQEVKSSDIAKTFRKAINRKEGICALGGTSELSSEGTQHS
YSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDE
RAINKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLF
ADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQKINNFSADIKDSK
AYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVS
GNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLY
VDLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKNQAKFSLVG
IGGQDLNDGNPTLTLAVVWQLMRRYTLNVMEDLGEGQKATDDIIVNWVNGTLSEAGKSTS
IQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKTGNLTEEDKHNNAKYAVSMARRIGARV
YALPEDLVEVKPKMVMTVFACLMGRGMKRV
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggacgagatggcaaccactcagatttccaaagatgagcttgatgaactcaaagaggcc
tttgcaaaagttgatctcaacagcaatggattcatttgcgactatgaacttcatgagctt
ttcaaggaagcgaatatgccattgcccggatataaagtgagagaaattattcaaaaactc
atgctggatggcgacagaaataaagatgggaagataagctttaatgaatttgtttatatt
ttccaagaggtaaagagcagtgacattgctaaaaccttccgcaaagccatcaacaggaaa
gaagggatttgtgctctgggaggaacttcagagttgtccagtgaaggaacccagcattcc
tactcagaggaagaaaaatatgctttcgttaattggataaataaagctttggaaaatgat
cccgattgcagacatgtcatacccatgaacccaaatactgatgacctattcaaagcagtt
ggtgatggaattgtgctctgcaaaatgatcaacctttctgttcccgatacaattgatgag
agagcaatcaataagaagaagcttacacccttcatcattcaggaaaacttgaacttggcc
ctgaattctgcttctgccattgggtgtcacgttgtgaacattggtgccgaagatctgcgt
gccgggaaacctcatctggtcttgggactgctctggcagattattaagattggcttattt
gctgacattgaattaagcaggaatgaagcactggcggctttgcttcgagatggtgagact
ctggaggagcttatgaaattgtctccagaagagcttctgctgagatgggccaacttccat
ctggaaaactcaggctggcaaaagatcaacaacttcagtgctgacatcaaggattccaaa
gcctatttccatctactcaatcaaattgcaccgaaaggacagaaggaaggggaaccacgg
atagatattaacatgtcaggtttcaacgaaacagatgatttaaagagagccgaaagtatg
cttcagcaagcagataaattaggctgcagacagttcgttaccccggctgatgttgtgagc
ggaaaccccaaactgaacttggcctttgtagccaacctctttaataaatatccagcacta
actaaacctgagaaccaggatattgattggactcttctagaaggagaaactcgtgaagaa
agaacctttcgtaactggatgaactctcttggtgtgaatccccatgtcaaccatctctat
gttgacctgcaggatgccctggtgatcttacagctgtatgagagaattaaagttcctgtg
gactggagtaaagttaacaagcctccatacccaaagctgggtgccaacatgaaaaagtta
gaaaactgcaactatgcagttgaattagggaagaatcaagctaaattctccttggttggc
attggaggacaagacttgaatgatgggaacccaaccttgaccttggctgtagtctggcag
ctgatgagaagatatacccttaatgttatggaagatcttggagagggtcagaaagcaact
gatgacatcattgtaaactgggtcaatggaacattgagtgaagctggaaagtcaacttct
attcagagttttaaggacaagacgatcagctccagtttggcagttgtggatttaattgat
gccatccagccaggctgcattaactatgaccttgtgaagactggaaatctaacagaagaa
gacaagcacaataacgccaagtatgcagtgtcgatggctagaagaataggagccagagtg
tatgctctccctgaagaccttgtggaagtaaaaccgaagatggtcatgaccgtgtttgcc
tgtttgatgggcagagggatgaagagagtgtga

DBGET integrated database retrieval system