KEGG   Rattus norvegicus (rat): 81749
Entry
81749             CDS       T01003                                 

Gene name
Prkch
Definition
(RefSeq) protein kinase C, eta
  KO
K18051  novel protein kinase C eta type [EC:2.7.11.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04270  Vascular smooth muscle contraction
rno04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    81749 (Prkch)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    81749 (Prkch)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    81749 (Prkch)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    81749 (Prkch)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     81749 (Prkch)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   81749 (Prkch)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   81749 (Prkch)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C Kinase-like C1_2 FTA2 APH RIO1 Kdo
Other DBs
NCBI-GeneID: 81749
NCBI-ProteinID: NP_112347
RGD: 621888
Ensembl: ENSRNOG00000004873
UniProt: Q64617
Position
6q24
AA seq 683 aa
MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTK
QKTNKPTYNEEFCTNVSDGGHLELAVFHETPLGYDHFVANCTLQFQELLRTAGTSDTFEG
WVDLEPEGKVFVVITLTGSFTEATLQRDRIFKHFTRKRQRAMRRRVHQVNGHKFMATYLR
QPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTACTCQNNINKVDAKIAEQRF
GINIPHKFNVHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIRCQANVAPNCGVNAV
ELAKTLAGMGLQPGNISPTSKLISRSTLRRQGKEGSKEGNGIGVNSSSRFGIDNFEFIRV
LGKGSFGKVMLARIKETGELYAVKVLKKDVILQDDDVECTMTEKRILSLARNHPFLTQLF
CCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHEKGIIYRDL
KLDNVLLDHEGHCKLADFGMCKEGICNGVTTATFCGTPDYIAPEILQEMLYGPAVDWWAM
GVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLHEDATGILKSFMTKNPTMRLGSL
TQGGEHEILRHPFFKEIDWVQLNHRQLEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDE
GHLPMINQDEFRNFSYVSPELQP
NT seq 2052 nt   +upstreamnt  +downstreamnt
atgtcgtccggcacgatgaagttcaatggctatctgagggtccgcatcggagaggcagtg
gggctgcagcccacccgctggtccctgcggcactcgctcttcaaaaagggccaccagctg
ctggacccctacctgacggtgagcgtagaccaggtacgcgtgggccagaccagcacaaag
cagaagactaacaaacccacctacaacgaggagttctgcaccaatgtctccgacggcggc
cacctggagctagccgtcttccacgagacgcccctgggctatgaccactttgtggccaac
tgcacgctgcagttccaggagctgttgcgcacggccggcacatcggacaccttcgagggc
tgggtggatctggagcctgaggggaaagtgttcgtggtaataaccctaacagggagcttc
actgaagccactctccagagagaccgcatcttcaagcattttaccaggaagcgccaacgg
gctatgcgaaggagagtccatcaagtcaacggacacaagttcatggccacatacctgagg
cagcccacctactgctctcactgccgggagttcatctggggagtatttgggaaacagggt
tatcaatgccaagtgtgcacctgcgtcgtccataaacgctgccatcacctaattgttaca
gcctgcacttgccaaaacaatattaacaaagtggatgccaagatcgcagagcaacggttt
ggcatcaacatcccacacaagttcaacgttcacaactacaaggtgcccacgttctgcgac
cactgtggctccctgctctgggggataatgcgacaaggacttcagtgtaaaatatgtaag
atgaacgtacatattcggtgtcaggcgaacgtggccccaaactgcggggtgaacgccgtg
gagcttgccaagaccctggcagggatgggtctccaacccggaaatatttctccaacctcg
aaactcatttccaggtctacgctgagacggcaggggaaggagggctccaaagaaggaaat
gggatcggtgttaattcttccagcagattcggcatcgacaactttgagttcatccgggtg
ttggggaaggggagcttcgggaaggtgatgctcgccagaataaaggagacaggagagctg
tacgctgtgaaggtgctgaagaaggacgtcatcctgcaggatgacgatgtggaatgcacc
atgactgagaagaggatcctctccttggcccgcaaccaccccttcctcacccagctcttc
tgctgctttcagactcctgaccgtctgttctttgtcatggagtttgtgaacggaggtgac
ctgatgttccacatccaaaagtccaggcgtttcgatgaagcccgagctcgtttctacgct
gcagagatcatttctgcactcatgttcctccacgagaaaggcatcatctacagagacttg
aaactggacaacgtactactggaccacgaaggccactgtaaactggccgacttcggaatg
tgcaaggagggcatttgtaacggggtcaccacagccaccttctgcggcacgcctgactac
attgccccagagatccttcaggagatgttgtatggacctgcagtagactggtgggccatg
ggcgtgttgctttatgagatgctgtgcggacatgcgcccttcgaggctgagaatgaagat
gacctttttgaggccatactgaatgatgaagttgtctaccctacctggctccatgaagat
gccacagggatcctcaaatctttcatgaccaagaaccccaccatgcgcttgggcagcctg
actcagggaggcgagcatgagatcttgagacatcctttctttaaggaaatcgactgggtc
cagttgaaccatcgccagctagaaccgcctttccgacccagaatcaaatcccgagaagac
gtcagcaattttgacccagacttcataaaagaagagcctgttttaactccgatcgatgag
ggacatcttcctatgattaaccaggatgagtttagaaacttttcctatgtgtcaccagaa
ttgcaaccgtag

DBGET integrated database retrieval system