KEGG   Rattus norvegicus (rat): 81751
Entry
81751             CDS       T01003                                 

Symbol
Psen2
Name
(RefSeq) presenilin-2
  KO
K04522  presenilin 2 [EC:3.4.23.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04330  Notch signaling pathway
rno04722  Neurotrophin signaling pathway
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    81751 (Psen2)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    81751 (Psen2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    81751 (Psen2)
   05022 Pathways of neurodegeneration - multiple diseases
    81751 (Psen2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    81751 (Psen2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-  
     81751 (Psen2)
Peptidases and inhibitors [BR:rno01002]
 Aspartic peptidases
  Family A22: presenilin family
   81751 (Psen2)
SSDB
Motif
Pfam: Presenilin
Other DBs
NCBI-GeneID: 81751
NCBI-ProteinID: NP_112349
RGD: 621060
Ensembl: ENSRNOG00000002879
UniProt: O88777
Position
13
AA seq 448 aa
MLTFMASDSEEEVCDERTSLMSAESPTSRSCQDSRPGPEDGENTAQWRSQENEDDCEEDP
DHYACSGVPGRPSGLEEELTLKYGAKHVIMLFVPVTLCMIVVVATIKSVRFYTEKNGQLI
YTPFTEDTPSVGQRLLNSVLNTLIMISVIVVMTIFLVVLYKYRCYKFIHGWLIMSSLMLL
FLFTYIYLGEVFKTYNVAMDYPTLFLAVWNFGAVGMVCIHWKGPLVLQQAYLIVISALMA
LVFIKYLPEWSAWVILGAISVYDLVAVLCPKGPLRMLVETAQERNEPIFPALIYSSAMVW
TVGMAKLDPSSQGALQLPYDPEMEEDSYDSFGEPSYPEAFEAPQPGYPGEEPEEEEERGV
KLGLGDFIFYSVLVGKAAATGNGDWSTTLACFIAILIGLCLTLLLLAVFKKALPALPISI
TFGLIFYFSTDNLVRPFMDTLASHQLYI
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgctcacattcatggcctctgatagcgaggaagaggtgtgcgatgagcggacgtccttg
atgtcagccgagagccctacatcacgttcctgccaggacagcaggccaggcccagaggat
ggagagaacactgcccagtggaggagccaggagaacgaggacgactgtgaggaggacccg
gaccactatgcctgcagtggggttcctgggcgaccatcgggcctggaggaggagctgacc
ctcaagtatggggcgaagcacgtgatcatgctgttcgtgcctgtcacgctgtgcatgatt
gtggtggtggccaccatcaagtccgtgcgtttctacacggagaagaacgggcagctcatc
tacacgcccttcaccgaggacacaccctctgtgggccagcggctcctcaactccgtgctg
aacactctgatcatgatcagcgtcattgtggtcatgactatcttcctagtggtactctac
aaatatcgctgttacaagttcatccatggctggctgatcatgtcctccctgatgctcctc
ttcttgttcacctacatctacctcggggaagtgttcaagacctacaatgtggccatggac
taccccacactgttcctggctgtctggaacttcggggcagtgggcatggtgtgcatccac
tggaagggtcccctggtgctccagcaggcttacctcattgtgatcagcgcactcatggcc
ctggtgttcatcaagtacctgccggagtggtccgcttgggtcatcttgggcgccatctct
gtgtacgatctcgtggctgtgctgtgccccaaagggccactgaggatgctggtggaaact
gcccaggaaagaaacgagcccatatttcctgccctcatatactcatctgccatggtgtgg
acggtaggcatggcgaagctggacccctcctctcagggagcactgcagctcccttacgat
ccagagatggaagaagactcctatgacagttttggggaaccctcataccctgaagccttc
gaagctccccagcctggctacccaggggaagagccggaggaggaggaggaaaggggtgta
aagcttggtctgggagacttcatcttctacagcgttctggtgggcaaggcagcagccaca
ggcaacggagactggagcacgacgctggcctgctttatcgccatcctcattggcttgtgt
ctcaccctcctgctgctcgccgtgttcaagaaggccctgcccgccctccccatctccatc
accttcgggctcatcttttacttctccacagacaacctggtgcgtcctttcatggacacg
ttggcctcccaccagctctacatctga

DBGET integrated database retrieval system