KEGG   Rattus norvegicus (rat): 81758Help
Entry
81758             CDS       T01003                                 

Gene name
Rbl2, Rb2
Definition
(RefSeq) RB transcriptional corepressor like 2
  KO
K16332  retinoblastoma-like protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04110  Cell cycle
rno04151  PI3K-Akt signaling pathway
rno04218  Cellular senescence
rno05165  Human papillomavirus infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    81758 (Rbl2)
   04151 PI3K-Akt signaling pathway
    81758 (Rbl2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    81758 (Rbl2)
   04218 Cellular senescence
    81758 (Rbl2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    81758 (Rbl2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    81758 (Rbl2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    81758 (Rbl2)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain Rb
    81758 (Rbl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RB_A RB_B DUF3452 TFIIB
Motif
Other DBs
NCBI-GeneID: 81758
NCBI-ProteinID: NP_112356
RGD: 3541
Ensembl: ENSRNOG00000012153
UniProt: O55081
Position
19p11
AA seq 1135 aa AA seqDB search
MASGGNQSSPPPPAAAASSEEEEEDGDTADRAQPAGSPSHQIQQRFEELCSRLNMDEAAR
AEAWSSYRSMSESYTLEGNDLHWLACALYVACRKSVPTVSKGTAEGNYVSLTRILRCSEQ
SLIEFFNKMKKWEDMANLPPHFRERTERLERNFTVSAVIFKKYEPIFQDIFKYPQEEQPR
QQRGRKQRRQPCTTSEIFHFCWVLFIYAKGNFPMISDDLVNSYHLLLCALDLVYGNALQC
SNRKELVNPNFKGVSEDGHPRDSHPSSDPPCVIEKLCSLHDGLVLEAKGIKQHFWKPYIR
KLFEKKLLRGKEENLTGFLEPGNFAESFKAVNKAYEEYVLATGSLDERIFLGEDAEEEVG
TFSRCVSAASGTESAERTQMRDILQQHLDKSKTLRVCNPLTGVRYVQENSPCVTPVSTAT
HSLNRLHTMLAGLRNAPSEKLEQILRSCSRDPTRAIADRLREMYEIYSQHFQPDENVSNC
AKEMANKHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGVLEQDAFHKSLLACCLEVVAFS
YKPPGNFPFIAEIFDVPHYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWKTKS
PLWDRIRDNENRVPTCEEVTPPHNLERTDEIYIAGSPLTPRRVGEVRTDAGGLGRSVTSP
TTLYDRYSSPTVSTTRRRLFESDSPSEGSTAGRIPPQPLVNAVPVQNVSGETVSVTPVPG
QTLVTMATATVTANNGQTVTIPVQGIANENGGITFFPVQVNVGGQAQAVTGSIQPLSAQA
LAGSLSSQQVTGTTLQVPGPVAIQQISPGGQQQNQGQPLTSSSIRPRKTSSLSLFFRKVY
YLAGVRLRDLCTKLDISDELRKKIWTCFEFSIVQCPELMMDRHLDQLLMCAIYVMAKVTK
EDKSFQNIMRCYRTQPQARSQVYRSVLIKGKRRNSGSCENRSHQNSPTELNTDRASRDSS
PVMRSNSTLPVPQPSSAPPTPTRLTGANSDIEEEERGDLIQFYNNIYRKQIQTFAMKYSQ
ANSQMDTPPLSPYPFVRTGSPRRVQLSQSHPIYISPHKNEAMLSPREKIFYYFSNSPSKR
LREINSMIRTGETPTKKRGILLDDGSESPAKRICPENHSALLRRLQDVANDRGSH
NT seq 3408 nt NT seq  +upstreamnt  +downstreamnt
atggcatctggaggcaaccagtcgtcacctcctcctcctgctgctgcagccagctcagag
gaagaggaggaggatggcgacaccgcggaccgggcgcagcccgcagggtccccaagccat
cagatccaacagcggttcgaagagctgtgcagccgccttaacatggacgaggcggcacgg
gccgaggcctggagcagctaccgcagcatgagcgagagctacacgctggagggaaatgat
ctccattggttagcatgtgccttatatgtggcttgcagaaaatctgttcctactgtgagc
aaagggactgctgaaggaaactatgtgtctttaactagaatccttcgatgttctgagcaa
agcctaattgaattttttaacaagatgaagaagtgggaagatatggcaaatttaccccca
cacttccgagaacgaaccgaaagattagaaagaaacttcactgtctccgctgtgatcttt
aagaaatatgaacccatttttcaagacatttttaaatatccccaagaagaacaacctcgc
cagcaaagaggaagaaagcagaggcgacagccctgtaccacatctgaaattttccatttt
tgttgggtgctttttatatacgcaaaaggaaacttccccatgatcagtgatgatctggtc
aattcctaccatcttctgctgtgtgcactagatttagtttatggaaatgccctacaatgc
tctaaccggaaagaacttgtgaaccctaattttaaaggcgtgtccgaggacggccacccc
agggactctcacccgtcctctgatccaccgtgtgtcattgagaagctctgctccttacac
gacggcctagtgctggaggcaaaggggataaagcagcatttctggaaaccctacattagg
aagctttttgaaaagaagctcctcagggggaaggaagaaaatctcactggcttcctggag
cccgggaacttcgcagagagctttaaggctgttaataaggcgtatgaagaatacgtgtta
gccactgggagtctggatgagcggatatttcttggcgaggatgcggaggaggaagttgga
actttctcacggtgtgtaagtgctgcctcgggcacagagagtgccgaacgaacgcagatg
agagacatcttgcagcagcatcttgacaagtctaaaacacttagagtctgcaacccactg
actggcgtgcggtatgttcaggagaacagcccttgtgtgactcccgtctccacagcaaca
cacagcctgaaccgtcttcacaccatgctggccggcctcaggaatgcacccagtgagaag
ctagaacagatactcaggtcatgttcccgagatccgactcgggctatcgctgacaggttg
agagagatgtatgaaatatattctcagcatttccagccagacgagaatgttagtaattgt
gctaaagaaatggccaacaaacactttcgttttgcagaaatgctttactataaagtatta
gagtctgttattgagcaagaacagaagagattgggagacatggacttatctggtgttctg
gagcaagatgcattccataagtcactcctggcctgctgccttgaggtggtcgctttttcc
tataagcctcctggaaatttcccatttattgctgaaatatttgatgtaccacattatcat
ttttataaggtaatagaagtatttattagagcagaagacggtctttgcagagaagtggtc
aaacacctcaatcagattgaagaacaaattttagaccacttggcatggaaaaccaagtcc
ccactgtgggatagaattagagataatgaaaacagagtccctacatgtgaagaggttaca
ccacctcacaacctagagagaacagatgaaatctatattgctggctctcccttaactccg
agaagggtgggtgaagttcgcactgatgctggaggacttggaagaagtgtgacatctcca
accacactgtatgacaggtacagttccccaacagtcagtactactagaaggcggctattt
gagagtgacagtccctctgaaggaagcacggctgggcgcatccccccacaacccctagtc
aatgctgtccctgtgcagaatgtatctggggagactgtttctgtcacaccagttcctgga
cagaccttggtcaccatggcaacagccactgtcacagccaacaatggacaaacagtgacc
attccagtacaaggtattgccaacgaaaatggagggataacattcttcccagtccaagtg
aatgttgggggccaggcacaggctgtgactggctctatccagcccctcagtgctcaagcg
ctggctggaagtctgagttcccaacaggtgacaggaacaactttgcaagtccccggtccg
gtggccattcaacaaatttcccctggaggacaacagcagaaccaaggccagccgttaacc
agcagcagtatcaggcctcggaagactagctccttatcacttttctttagaaaggtttac
tacttagctggtgtccgccttcgagacctttgtacaaaactagatatttcagatgaactg
aggaaaaaaatttggacctgctttgaattctctatagtccagtgtcctgaacttatgatg
gacagacatctggaccagttgttaatgtgtgccatttacgtgatggcaaaggtcacaaaa
gaagacaagtccttccagaatatcatgcgctgttacaggactcagccacaggcccggagc
caggtatacagaagtgtcttgataaaagggaaaagaagaaattctggcagctgtgagaac
agaagccatcagaattctccaacagaactaaatacagacagagccagtagagactccagt
ccagttatgaggtcaaacagcaccttaccagttccacagcccagcagtgcccctcctaca
ccaactcgactcacaggtgccaacagtgacattgaagaggaggaaagaggagacctcatt
cagttctacaacaacatctacaggaaacaaatccaaacgtttgccatgaagtactcacag
gcaaactcccaaatggacacccctcccctgtctccctatccgtttgtaagaacgggctcc
cctcgccgagtacagttatctcaaagtcaccctatctacatttccccacataaaaacgaa
gcaatgctttctcctcgagagaagattttttactacttcagcaacagcccatcaaagaga
ctgagagaaattaacagtatgatacggacaggagagactccaactaaaaagagagggatt
ctcttggacgatggaagtgaatcgcctgcaaaaagaatttgcccagaaaatcattctgct
ctgttacgtcgtctccaagatgtagctaatgaccgaggttcacactga

DBGET integrated database retrieval system