KEGG   Rattus norvegicus (rat): 81760
Entry
81760             CDS       T01003                                 

Gene name
Grk1
Definition
(RefSeq) rhodopsin kinase GRK1
  KO
K00909  rhodopsin kinase [EC:2.7.11.14]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
rno04144  Endocytosis
rno04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    81760 (Grk1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    81760 (Grk1)
  09157 Sensory system
   04744 Phototransduction
    81760 (Grk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    81760 (Grk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.14  rhodopsin kinase
     81760 (Grk1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   81760 (Grk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS Pkinase_fungal Kinase-like FTA2 ABC1
Other DBs
NCBI-GeneID: 81760
NCBI-ProteinID: NP_112358
RGD: 619712
Ensembl: ENSRNOG00000018430
Vega: OTTRNOG00000000950
UniProt: Q63651
Position
16
AA seq 564 aa
MDFGSLETVVANSAFIAARGSFDGSSTPSSRDKKYLAKLRLPPLSKCEGLRDSISLEFDN
LCSEQPIGKRLFQQFLKTDERHVPALELWKDIEDYDTADDDLRPQKAQAILAEYLDPQGT
LFCNFLDQGMVARVKEGPTGSQDGLFQPLLQATLEHLSQGPFQEYLGSLYFLRFLQWKWL
EAQPIGEDWFLDFRVLGKGGFGEVSACQMKATGKMYACKKLNKKRLKKRKGYQGAIVEKR
ILAKVHSRFIVSLAYAFETKTDLCLVMTIMNGGDVRYHIYNVDEENPGFPEPRAIYYTAQ
IISGLEHLHQRRIVYRDLKPENVLLDNDGNIRISDLGLAVELKEGQNKTKGYAGTPGFMA
PELLRGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENKELKQRIISEPVKYPEKFS
QASKDFCEQLLEKDPEKRLGFRDGTCDALRANVLFKDISWRQLEAGMLIPPFIPDSRTVY
AKNIQDVGAFSTVKGVVFDKADTEFFQEFASGNCSIPWQEEMIETGFFGDLNVWRPDGQM
PDDMKGITVEEAAPTAKSGMCLIS
NT seq 1695 nt   +upstreamnt  +downstreamnt
atggatttcgggtccttggaaaccgtggtggccaactctgccttcattgcggcccgaggc
agctttgacggaagcagcaccccctcttcccgagacaagaagtatctggccaagctccgg
ttgcccccactgtccaagtgtgagggtctccgtgacagcatcagcctagagtttgacaac
ctgtgctcggagcagcccattggcaagaggctcttccagcagttcctgaagacagacgag
aggcatgtgccggctctggagctctggaaggacatcgaggactatgacactgccgatgac
gacctacggccacagaaggctcaggccatcctggctgagtacctggacccacagggcaca
ctcttctgcaacttcctggaccagggcatggtggcaagagtgaaggaagggccaactggg
agccaggatgggctcttccagcctctgctgcaggccacactggagcacttgagtcagggc
cccttccaggagtacctgggaagcctatatttcctgcggtttcttcagtggaagtggttg
gaagcccagcccataggtgaagactggtttttggacttcagggtcctggggaaggggggc
tttggggaagtgtccgcctgccaaatgaaggcgaccggcaagatgtacgcttgcaagaag
ctgaacaagaagcggctgaagaagaggaaggggtaccagggcgccatcgttgagaagagg
attctagctaaagtacacagcaggttcatcgtgtctctggcctatgcattcgaaaccaag
accgacctctgtctggtgatgaccatcatgaatggaggtgacgtaaggtaccacatctac
aatgtggatgaggagaaccccggctttccggagccacgagccatctactacacagcacag
atcatcagtggcctggagcacctgcatcagagacgcattgtctaccgtgacctcaagcca
gagaacgtgctgctggacaacgatggcaacatccgaatttctgaccttggactggccgtc
gagttgaaggaagggcagaataagaccaagggctatgcagggaccccaggtttcatggcc
cccgagctcctgcgaggcgaagagtacgacttctctgtggactactttgccctgggggtc
acattgtacgagatgatcgcagccagaggacccttccgagcccgaggagagaaggtggag
aacaaggagcttaaacagcgcatcatctcagagcccgtgaagtacccagagaagttcagc
caggccagcaaggacttctgtgagcagctgttagagaaggacccggagaagcgcctgggt
ttccgggatggaacctgtgacgccctaagggcgaatgtcctcttcaaagatatcagctgg
agacagctcgaagccggaatgctcatccctccgttcatcccagactctaggactgtctat
gccaagaacattcaggatgtgggtgccttttccacagtcaagggtgtggtttttgacaaa
gcagacacagaattcttccaagaattcgcctccggcaactgctccattccctggcaggag
gagatgattgagactgggttcttcggggacctcaacgtgtggcgcccagacggtcaaatg
cccgatgacatgaagggaatcaccgtggaggaggcagcccctacagccaaatcagggatg
tgtctcatctcctag

DBGET integrated database retrieval system