KEGG   Rattus norvegicus (rat): 81761Help
Entry
81761             CDS       T01003                                 

Gene name
Rnpep
Definition
(RefSeq) arginyl aminopeptidase
  KO
K01260  aminopeptidase B [EC:3.4.11.6]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    81761 (Rnpep)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.6  aminopeptidase B
     81761 (Rnpep)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M1
   81761 (Rnpep)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N Peptidase_MA_2
Motif
Other DBs
NCBI-GeneID: 81761
NCBI-ProteinID: NP_112359
RGD: 621137
Ensembl: ENSRNOG00000006720
UniProt: O09175
Position
13q13
AA seq 648 aa AA seqDB search
MESSGPSSCHSAARRPLHSAQAVDVASASSFRAFEILHLHLDLRAELPPGPGPGSRGLNG
KATLELRCLLPEGASELRLDSHSCLEVMAATLLRGQPGDQQQLTEPVPFHTQPFSHYGQA
LCVVFPKPCCAAERFRLELTYRVGEGPGVCWLAPEQTAGKKKPFVYTQGQAVLNRAFFPC
FDTPAVKCTYSALVEVPDGFTAVMSASTWERRGPNKFFFQMSQPIPSYLIALAIGDLASA
EVGPRSRVTEPCLIEAAKEEYNGVIEEFLATGEKLFGPYVWGRYDLLFMPPSFPFGGMEN
PCLTFVTPCLLAGDRSLADVIIHEISHSWFGNLVTNANWGEFWLNEGFTMYAQRRISTIL
FGAAYTCLEAATGRALLRQHMDVSGEENPLNKLRVKIEPGVDPDDTYNETPYEKGYCFVS
YLAHLVGDQEQFDKFLKAYVDEFKFQSILAEDFLEFYLEYFPELKKKGVDSIPGFEFNRW
LNTPGWPPYLPDLSPGDSLMKPAEELAELWAASEPDMQAIEAVAISTWKTYQLVYFLDKI
LQKSPLPPGNVKKLGETYPKISNAQNAELRLRWGQIILKNDHQEEFWKVKDFLQSQGKQK
YTLPLYHAMMGGSEMARTLAKETFSATASQLHSNVVNYVQQILAPKGS
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggagagcagcggacccagcagctgccacagcgcggcccggcggccacttcactcggca
caagccgtggacgtggcctcggcctccagtttccgcgccttcgagatcctgcacctgcac
ctggacctgcgggccgagttgcctccgggcccgggtccggggagccgcggactgaacggc
aaggcgacgctggaactgcgctgcttgctgccggagggcgcctcggagctgcggctcgat
tcgcacagttgcctggaggtgatggcggcgaccctgctgcgggggcagcccggagaccag
cagcagctcacggagcccgtgcctttccacacacagcccttctcgcactatggccaggcc
ctgtgcgtggtctttccgaagccctgctgtgccgccgagcgcttccggctggagctcacc
taccgcgtcggagagggaccaggggtttgctggttagctcctgagcagacagcaggaaag
aagaaaccctttgtgtatacccagggtcaggcagtcttaaaccgagcctttttcccttgc
ttcgacaccccagccgtgaaatgcacgtattcggctcttgttgaggttccagatggcttc
acagctgtgatgagtgcaagcacatgggagaggagaggaccaaataagttcttcttccag
atgagccagcccatcccctcctatctgatagctttggccattggagatctggcttcagct
gaggttggacccaggagccgggtgacagagccctgcctgattgaagccgccaaggaggaa
tacaatggggtcatagaagaatttctggcaacaggagagaagcttttcggaccctatgtt
tggggaagatatgatttactctttatgccaccatctttcccgtttggaggaatggagaat
ccctgcctgacctttgtcaccccgtgcctgctagcaggggaccgatccttagccgacgtc
atcatccacgagatctcccacagttggtttgggaacctggtcaccaatgccaactggggg
gaattctggctcaatgaaggcttcaccatgtatgcccagaggaggatctccaccatcctg
ttcggagctgcttacacttgcttggaggccgcaacggggagggctctgctacggcagcac
atggatgtgtctggagaggaaaacccactcaacaagcttcgggtgaagattgaaccaggt
gttgacccagatgacacctacaatgaaaccccctacgagaaaggttactgctttgtctca
tacctggcccatctggtgggtgatcaggaacagtttgacaagtttctcaaggcctatgta
gatgagtttaagttccaaagtatcttggctgaagactttctggaattctacctggagtat
ttccctgagctgaagaagaagggagtggattccatcccaggttttgagttcaaccgatgg
ctgaacacccctggctggcccccctacctccccgacctctcccctggggactcactcatg
aagccagctgaagagctggcggagctgtgggcagcctcagagccagacatgcaagccatc
gaggctgtggccatctctacctggaagacctaccagcttgtctacttcctagataagatc
ctgcagaagtctcctctccctcctgggaacgtgaaaaaacttggggagacatacccaaag
atttccaatgctcagaatgctgagttacggctaagatggggccaaatcatccttaagaat
gaccaccaagaagagttctggaaagtgaaggacttcctgcagagtcagggaaagcagaag
tacactctgccactgtaccatgccatgatgggtggcagcgagatggcccggaccctcgcc
aaggagaccttttcagccaccgcttcccagctccacagtaacgtggtcaactatgtccag
cagatcctggcgcccaagggcagttag

DBGET integrated database retrieval system