KEGG   Rattus norvegicus (rat): 81762
Entry
81762             CDS       T01003                                 

Gene name
Rock1, P160Rock, ROCK-I
Definition
(RefSeq) Rho-associated coiled-coil containing protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04071  Sphingolipid signaling pathway
rno04270  Vascular smooth muscle contraction
rno04350  TGF-beta signaling pathway
rno04360  Axon guidance
rno04510  Focal adhesion
rno04530  Tight junction
rno04611  Platelet activation
rno04670  Leukocyte transendothelial migration
rno04810  Regulation of actin cytoskeleton
rno04921  Oxytocin signaling pathway
rno05135  Yersinia infection
rno05163  Human cytomegalovirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    81762 (Rock1)
   04071 Sphingolipid signaling pathway
    81762 (Rock1)
   04024 cAMP signaling pathway
    81762 (Rock1)
   04022 cGMP-PKG signaling pathway
    81762 (Rock1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    81762 (Rock1)
   04530 Tight junction
    81762 (Rock1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    81762 (Rock1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    81762 (Rock1)
   04670 Leukocyte transendothelial migration
    81762 (Rock1)
   04062 Chemokine signaling pathway
    81762 (Rock1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    81762 (Rock1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    81762 (Rock1)
  09158 Development and regeneration
   04360 Axon guidance
    81762 (Rock1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    81762 (Rock1)
   05206 MicroRNAs in cancer
    81762 (Rock1)
   05205 Proteoglycans in cancer
    81762 (Rock1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    81762 (Rock1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    81762 (Rock1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    81762 (Rock1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    81762 (Rock1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     81762 (Rock1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   81762 (Rock1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    81762 (Rock1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH C1_1 Cortex-I_coil KASH_CCD APH Pkinase_C
Other DBs
NCBI-GeneID: 81762
NCBI-ProteinID: NP_112360
RGD: 620424
Ensembl: ENSRNOG00000031092
UniProt: Q63644
Position
18p13
AA seq 1369 aa
MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTYYSNRRYLPSANPSENRSSSNV
DKNVQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLESA
VSQIEKEKMLLQHRINEYQRKVEQENEKRRNVENEVSTLKDQLEDLRKASQSSQLANEKL
TQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSVSQLESLNRELQERNRMLENSKSQAD
KDYYQLQAVLEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLERVEGERKEAQDMLN
HSEKEKNNLEIDLNYKLKSIQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEEREAREKAENRVVETEKQCSMLDVDLKQSQQKLEHLTENKERLEDAVKSLTLQLEQES
NKRILLQSELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLRKIQELQSEKETLSTQLDLAETKAE
SEQLARGILEEQYFELTQESKKAASRNRQEITDKDHTVSRLEEANNALTKDIELLRKENE
ELNERMRTAEEEYKLKKEEEISNLKAAFEKNISTERTLKTQAVNKLAEIMNRKDFKIDRK
KANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECTHRNELQMQL
ASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPVGSACIPYLFIFYSSSSRIEGWL
SVPNRGNIKRYGWKKQYVVVSSKKMLFYNDEQDKEQSSPSMVLDIDKLFHVRPVTQGDVY
RAETEEIPKIFQILYANEGECRKDIEVEPVQQGEKTNFQNHKGHEFIPTLYHFPANCEAC
AKPLWHVFKPPPALECRRCHVKSHRDHLDKKEDLIPPCKVSYDVTSARDMLLLACPQDEQ
KKWVTHLVKKIPKKAPSGFVRASPRTLSTRSTANQSFRKVVKNTSGKTS
NT seq 4110 nt   +upstreamnt  +downstreamnt
atgtcgactggggacagttttgagactcggtttgaaaaaatcgacaacctgctgcgggat
cccaaatcggaagtgaattcagattgtttgctggatggattggatgctttggtttatgat
ttggattttcctgccttaagaaaaaacaaaaatattgacaactttctaagcagatataaa
gacacaataaataaaattagagatttacggatgaaagctgaagattatgaagtagtaaag
gtaatcggcagaggtgcatttggagaagttcaattggtaaggcataaatccaccaggaag
gtttatgctatgaagcttctcagcaaatttgaaatgattaagagatctgattctgctttt
ttctgggaagaaagggacatcatggcatttgccaatagtccttgggttgttcagcttttt
tatgcattccaagatgaccgatatctctatatggtgatggagtacatgcctggtggagac
cttgtaaacctgatgagcaactacgatgtgcctgaaaagtgggcacgattctatactgca
gaagtagttctcgcattggatgcratccattccatgggttttattcatagagatgtgaag
cctgacaacatgctgctggataagtctggacatttgaagttagccgactttggtacttgt
atgaagatgaataaggaaggtatggtacgatgtgatacagcagttggaacacctgattat
atttcacctgaagtattaaaatcacaaggcggtgatggctattatggacgagagtgtgac
tggtggtcagttggtgtatttttatatgaaatgcttgtaggtgatacacctttttatgca
gattctttggttgggacgtacagtaaaattatgaaccataaaaattcacttactttccct
gatgataatgacatatcaaaagaggcgaaaaatctcatttgtgccttccttacggacaga
gaagtgagattgggcagaaatggtgtagaggaaatcaaacgtcatctcttcttcaaaaat
gatcagtgggcttgggaaacgctccgagacactgtagcaccagttgtgcctgatttaagt
agtgacattgatactagtaattttgatgacttagaagaagataaaggagatgaagaaaca
tttcctattccaaaagcttttgttggcaatcagctaccttttgtaggatttacatattat
agcaatcgtagatacttaccttcagcaaatcccagtgagaacagatctagctccaatgtg
gataaaaacgtgcaggaaagtttacagaaaacaatctacaagcttgaagaacaactgcat
aatgaaatgcaattaaaagatgaaatggagcaaaagtgcagaacttcaaacataaaacta
gacaagataatgaaagaattggatgaagaggggaatcaaagaagaaatctagaatctgcg
gtgtctcaaattgagaaagaaaagatgttgctacaacatagaattaatgagtaccaaaga
aaagtggaacaggaaaatgagaaaagaagaaatgtagaaaatgaagtttctacactaaag
gaccagttggaagacttacggaaagcaagtcagagctcacagcttgctaatgagaagctg
acacagttacagaagcagttagaagaagcgaatgacttacttaggacagaatcagacaca
gctgtaagattaaggaagagtcacacagagatgagcaagtcagttagtcagctggagtct
ctgaacagagagttacaggagagaaacagaatgttagagaattccaagtcacaagcagac
aaggattactaccagctgcaagctgtattggaagctgagcgaagagacagaggccatgat
tctgagatgattggagaccttcaagcacgaattacgtctttacaagaagaggtgaagcat
ctcaaacataatcttgaaagagtagaaggagaaagaaaagaggctcaagacatgctcaat
cattcagaaaaggaaaaaaataatttggagattgatttgaactacaagctcaagtctatt
cagcagaggttagaacaagaagtaaatgaacacaaagtaaccaaagcgcggctaactgac
aagcatcagtctattgaagaggcaaagtctgttgccatgtgtgaaatggaaaaaaagctg
aaggaagagagagaagctcgagagaaggctgaaaatagagttgttgagactgagaagcaa
tgttctatgctagatgttgacctgaaacagtctcagcagaagctagaacatttgaccgaa
aataaagaaaggctggaggatgcagttaagagtctcaccctgcagctggaacaggaatcc
aataagcggatcttgctacagagtgaactgaagactcaagcgtttgaagcagacaattta
aaagggttagaaaaacagatgaaacaggaaataaatactttattggaagctaaaagattg
ttagaatttgagttagctcagcttacaaagcaatacagaggaaatgaagggcaaatgcgg
gagttacaagatcagcttgaagctgagcaatatttctctacactttataaaacccaggta
aaggaacttaaagaagaaattgaagaaaaaaacagagaaaatttaaggaaaatacaggag
ctgcaaagtgaaaaagaaactctttcgactcagttggatttagcagaaacaaaagctgag
tctgagcagttggctcgaggaattctggaagaacagtattttgagttgactcaagaaagc
aagaaagctgcttcaagaaatagacaagagattacagataaagatcataccgttagtcgg
cttgaagaagcaaacaatgcgctaaccaaagatattgaactactaagaaaagaaaatgaa
gagctaaatgaaaggatgagaacagcagaagaagaatataaattgaagaaggaggaagaa
ataagtaatcttaaggctgcctttgaaaagaatatcagtaccgaacggacccttaaaaca
caggctgttaacaagttggcagaaataatgaatcgcaaagattttaaaattgataggaag
aaagctaatactcaagatttgagaaaaaaagaaaaggaaaatagaaagctccaactagaa
cttaaccaagaaagagaaaaatttaaccaaatggtggtgaaacaccagaaggagctgaat
gacatgcaagcgcaattggtagaagaatgtacacatagaaatgaacttcaaatgcagttg
gctagcaaagagagtgatattgagcagttgcgtgcaaaacttttggacctttcggattca
actagtgttgctagttttcccagtgctgatgagactgacggaaatcttccagttggttct
gcctgcattccttatttatttatcttctactcttctagttcaagaattgaaggttggctt
tctgtaccaaatagaggaaatatcaaaagatatggctggaagaaacagtatgttgtggtg
agcagcaaaaaaatgttgttctataatgatgagcaagataaggaacaatccagtccatct
atggtgttggacatagataaattgttccatgtccgacctgtaacccaaggagatgtgtac
agagctgaaactgaagaaattcctaaaatattccagatactgtatgcaaatgaaggtgaa
tgtagaaaagatatagaagtggaaccagttcaacaaggtgaaaaaactaatttccagaat
cacaaaggccatgaattcattcctaccctctaccactttccagccaactgcgaggcctgt
gccaaacctttgtggcatgtttttaagccaccgcctgccctagagtgtcgaagatgccat
gttaagtcccacagggaccatctagacaagaaagaggacttgattcccccatgcaaagta
agttatgatgtaacatcagcaagagatatgttgctgttagcatgtcctcaggatgaacaa
aagaaatgggtaactcatctggtaaagaagattcctaagaaggcaccttctggctttgtc
cgtgcctctcctcgaacgctgtcgacaagatctactgcaaatcagtctttccggaaagta
gtcaaaaatacatctggaaaaactagttaa

DBGET integrated database retrieval system