KEGG   Rattus norvegicus (rat): 81764
Entry
81764             CDS       T01003                                 

Gene name
Rpl10
Definition
(RefSeq) ribosomal protein L10
  KO
K02866  large subunit ribosomal protein L10e
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    81764 (Rpl10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rno03011]
    81764 (Rpl10)
Ribosome [BR:rno03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    81764 (Rpl10)
  Archaea
    81764 (Rpl10)
SSDB
Motif
Pfam: Ribosomal_L16
Other DBs
NCBI-GeneID: 81764
NCBI-ProteinID: NP_112362
RGD: 621178
Ensembl: ENSRNOG00000056765
UniProt: Q6PDV7
Position
Xq37
AA seq 214 aa
MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQL
SSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINKMLSCAGADRLQTGMRGAFG
KPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADE
FEDMVAEKRLIPDGCGVKYIPNRGPLDKWRALHS
NT seq 645 nt   +upstreamnt  +downstreamnt
atgggccgccgccccgcccggtgttatcgctattgtaagaacaagccatacccaaagtct
cgtttctgtcgtggtgtccctgatgctaagatccgcatctttgacttgggacggaagaaa
gcaaaagtggatgaatttccactttgtggccacatggtgtcagatgaatatgaacaactc
tcttctgaagctctggaggctgctcgtatttgtgccaacaaatacatggtaaagagttgt
ggcaaggatggctttcatatccgggtgaggctccaccctttccatgtcatccgtatcaac
aagatgttgtcctgtgctggggctgacaggctccagacaggtatgcgtggtgcctttggg
aaaccccaggggacagtagccagggttcacattggccaagtcatcatgtctatccgaacc
aagctgcagaataaggaacatgtgattgaggctctgcgcagggccaagttcaagttccct
ggccggcagaagatccacatctcaaagaaatggggttttaccaagttcaatgcagatgaa
tttgaagacatggttgctgagaagcggctcattcctgatggctgtggtgtcaaatatatc
cccaatcgtggtcctcttgacaagtggagagccctgcattcctga

DBGET integrated database retrieval system