KEGG   Rattus norvegicus (rat): 81778
Entry
81778             CDS       T01003                                 

Gene name
S100a10
Definition
(RefSeq) protein S100-A10
  KO
K17274  protein S100-A10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    81778 (S100a10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    81778 (S100a10)
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    81778 (S100a10)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   81778 (S100a10)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 EF-hand domain-containing proteins
  S100 proteins
   81778 (S100a10)
SSDB
Motif
Pfam: S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8
Other DBs
NCBI-GeneID: 81778
NCBI-ProteinID: NP_112376
RGD: 628655
Ensembl: ENSRNOG00000023226
UniProt: P05943 B3Y9H3
Position
2
AA seq 95 aa
MPSQMEHAMETMMLTFHRFAGEKNYLTKEDLRVLMEREFPGFLENQKDPLAVDKIMKDLD
QCRDGKVGFQSFLSLVAGLIIACNDYFVVHMKQKK
NT seq 288 nt   +upstreamnt  +downstreamnt
atgccatcccaaatggagcatgccatggaaaccatgatgcttacatttcacaggtttgca
ggggaaaaaaactacttgacaaaggaggacctgagagtgctcatggaaagggagttccct
gggtttttggaaaatcaaaaggaccctctggctgtggacaaaataatgaaagacctggac
cagtgccgagatggaaaagtgggcttccagagctttctatcactagtggcggggctcatc
attgcatgcaatgactattttgtagtacacatgaagcagaagaagtag

DBGET integrated database retrieval system