KEGG   Rattus norvegicus (rat): 81780
Entry
81780             CDS       T01003                                 

Gene name
Ccl5, Rantes, Scya5
Definition
(RefSeq) C-C motif chemokine ligand 5
  KO
K12499  C-C motif chemokine 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04668  TNF signaling pathway
rno05020  Prion disease
rno05142  Chagas disease
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
rno05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    81780 (Ccl5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    81780 (Ccl5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    81780 (Ccl5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    81780 (Ccl5)
   04621 NOD-like receptor signaling pathway
    81780 (Ccl5)
   04623 Cytosolic DNA-sensing pathway
    81780 (Ccl5)
   04062 Chemokine signaling pathway
    81780 (Ccl5)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    81780 (Ccl5)
  09164 Neurodegenerative disease
   05020 Prion disease
    81780 (Ccl5)
  09172 Infectious disease: viral
   05164 Influenza A
    81780 (Ccl5)
   05168 Herpes simplex virus 1 infection
    81780 (Ccl5)
   05163 Human cytomegalovirus infection
    81780 (Ccl5)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    81780 (Ccl5)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   81780 (Ccl5)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Chemokines
   81780 (Ccl5)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 81780
NCBI-ProteinID: NP_112378
RGD: 69069
Ensembl: ENSRNOG00000010906
Vega: OTTRNOG00000000482
UniProt: Q6PED1
Position
10q26
AA seq 92 aa
MKISTAASLTVILVAAALCTPAPASPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSN
LAVVFVTRRNRQVCANPEKKWVQEYINYLEMS
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaagatctccacagctgcatccctcaccgtcatcctcgttgcagccgccctctgcacc
cccgcacctgcctccccatatggctcggacaccactccctgctgctttgcctacctctcc
ctcgcactgccccgtgcccacgtgaaggagtatttttacaccagcagcaagtgctccaac
cttgcagtcgtctttgtcactcgaaggaaccgccaagtgtgtgccaacccagagaagaag
tgggttcaagaatacatcaactatttggagatgagctag

DBGET integrated database retrieval system