KEGG   Rattus norvegicus (rat): 81782Help
Entry
81782             CDS       T01003                                 

Gene name
Soat1, Acat-1
Definition
(RefSeq) sterol O-acyltransferase 1
  KO
K00637  sterol O-acyltransferase [EC:2.3.1.26]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00100  Steroid biosynthesis
rno04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    81782 (Soat1)
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    81782 (Soat1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.26  sterol O-acyltransferase
     81782 (Soat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MBOAT
Motif
Other DBs
NCBI-GeneID: 81782
NCBI-ProteinID: NP_112380
RGD: 621641
Ensembl: ENSRNOG00000004111
UniProt: O70536
Position
13q22
AA seq 545 aa AA seqDB search
MVGEETSLRNRLSRSAENPEQDEAQKNLLDTHRNGHITMKQLIAKKRQLAAEAEELKPLF
LKEVGCHFDDFVTNLIDKSASLDNGGCALTTFSILEEMKNNHRAKDLRAPPEQGKIFISR
RSLLDELFEVDHIRTIYHMFIALLIIFILSTLVVDYIDEGRLVLEFSLLAYAFGQFPIVI
WTWWAMFLSTLAIPYFLFQRWAHGYSKSSHPLIYSLIHGAFFLVFQLGILGFIPTYVVLA
YTLPPASRFILILEQIRLVMKAHSYVRENVPRVLSAAKEKSSTVPVPTVNQYLYFLFAPT
LIYRDSYPRTPTVRWGYVAMQFLQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLC
VFNSILPGVLMLFLSFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVH
DWLYYYVYKDLLWFFSKRFRPAAMLAVFALSAVVHEYALAVCLSYFYPVLFVLFMFFGMA
FNFIVNDSRKRPVWNIMVRASLFLGHGVILCFYSQEWYARQRCPLKNPTFLDYVRPRTWT
CRYVF
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggtgggagaagaaacgtctctgagaaaccggctgtcaagatctgctgagaatcctgag
caagatgaagcccagaaaaatctcttggacacacacagaaatggtcacattaccatgaaa
cagttgatagccaagaagaggcagttggcggcagaggcagaggagctgaagccactgttt
ctgaaggaagttgggtgtcactttgatgactttgtgaccaatctcattgacaagtctgca
tctctggacaatggcgggtgtgcgctcacgaccttctccattcttgaagaaatgaaaaac
aaccacagagccaaagatctgagagcacctccagaacaagggaagatatttatttcaagg
cggtctcttttagacgagctgtttgaagtggaccacatcagaacaatttaccacatgttc
attgccctcctcatcatcttcatccttagcacgctcgtggtggattacatcgatgaagga
aggctggtccttgagttcagtctcctggcttatgcttttggccaatttcctattgttatt
tggacatggtgggccatgttcctgtctacactggcaatcccctatttcctgttccagcgt
tgggcccatggttacagcaagagttcccacccactcatctattcccttatccatggcgca
ttcttcttggtctttcaacttggaatcctcggttttataccaacatatgttgtcttagca
tacacgctgcccccagcctcccggttcattctgatacttgagcagattcgtttggtaatg
aaggctcactcatatgtcagagagaatgtgccacgagttctaagtgcagccaaggagaaa
tcgagcacggttccagtacccacagtcaaccagtacctgtacttcctgtttgctcctaca
cttatttaccgagacagctaccccaggactcctactgtaagatggggttatgttgctatg
cagtttttacaggtttttggttgcctgttttatgtgtactacatctttgagagactctgt
gcccctctgttccggaatatcaaacaggagccctttagtgctcgtgtcctggtcctgtgt
gtatttaactccatcttgccaggtgtgctgatgctgttcctttcgttctttgcctttttg
cactgctggctcaatgcctttgctgaaatgttacgctttggtgacaggatgttttataag
gactggtggaactctacatcgtactccaactactacaggacctggaatgtggtggtccac
gactggctctactactatgtttacaaggacctcctctggtttttctcgaagaggttcagg
cctgccgccatgttggccgtgttcgccctgtcagcagtggtgcacgagtacgccctcgct
gtctgcctgagctacttctacccagtgctcttcgtgctcttcatgttctttggaatggct
tttaacttcatcgttaacgacagtcggaaaaggccagtctggaacatcatggttcgggct
tccctcttcctcggccatggagtcattctgtgcttttactctcaagagtggtatgctcga
cagcgctgtcctctgaagaaccctacatttctggattatgtccggccacggacctggact
tgtcgttacgtgttttag

DBGET integrated database retrieval system