KEGG   Rattus norvegicus (rat): 81810Help
Entry
81810             CDS       T01003                                 

Gene name
Tgfbr2, TGF-beta_2, Tgfbr2T
Definition
(RefSeq) transforming growth factor, beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04060  Cytokine-cytokine receptor interaction
rno04068  FoxO signaling pathway
rno04144  Endocytosis
rno04218  Cellular senescence
rno04350  TGF-beta signaling pathway
rno04380  Osteoclast differentiation
rno04390  Hippo signaling pathway
rno04520  Adherens junction
rno04659  Th17 cell differentiation
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05142  Chagas disease (American trypanosomiasis)
rno05161  Hepatitis B
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05220  Chronic myeloid leukemia
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    81810 (Tgfbr2)
   04350 TGF-beta signaling pathway
    81810 (Tgfbr2)
   04390 Hippo signaling pathway
    81810 (Tgfbr2)
   04068 FoxO signaling pathway
    81810 (Tgfbr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    81810 (Tgfbr2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    81810 (Tgfbr2)
  09143 Cell growth and death
   04218 Cellular senescence
    81810 (Tgfbr2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    81810 (Tgfbr2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    81810 (Tgfbr2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    81810 (Tgfbr2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    81810 (Tgfbr2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    81810 (Tgfbr2)
   05202 Transcriptional misregulation in cancer
    81810 (Tgfbr2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    81810 (Tgfbr2)
   05212 Pancreatic cancer
    81810 (Tgfbr2)
   05225 Hepatocellular carcinoma
    81810 (Tgfbr2)
   05226 Gastric cancer
    81810 (Tgfbr2)
   05220 Chronic myeloid leukemia
    81810 (Tgfbr2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    81810 (Tgfbr2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    81810 (Tgfbr2)
   05161 Hepatitis B
    81810 (Tgfbr2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    81810 (Tgfbr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    81810 (Tgfbr2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     81810 (Tgfbr2)
Protein kinases [BR:rno01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   81810 (Tgfbr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ecTbetaR2 Pkinase_Tyr Pkinase Haspin_kinase Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 81810
NCBI-ProteinID: NP_112394
RGD: 69651
Ensembl: ENSRNOG00000013265
UniProt: P38438
Position
8q32
AA seq 567 aa AA seqDB search
MGRGLLRGLWPLHIVLWTRIASTIPPHVPKSVNSDLMAGDNSGAVKLPQLCKFCDVTLST
CDNQKSCMSNCSVTSICEKPQEVCVAVWRKNDKNITLETVCHDPKFTYHGFTLEDATSPT
CVMKEKKRAGETFFMCSCNTEECNDYIIFNEEYTTSSPDLLLVIIQVTGVSLLPPLGIAI
AVIAIFYCYRVHRQQKLSPSWESSKPRKLMDFSDNCAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYSSWKTEKDIFSDINLK
HENILQFLTAEERKTEMGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAH
LHSDHTPCGRPKMPIVHRDLKSSNILVRSDLTCCLCDFGLSLGLSPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENMESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSRVRE
HPCVESMKDNVLRDRGRPEIPSFWLNHQGIQIVCETLTECWDHDPEARLTAQCVAERFSE
LEHPDRLSGRSCSQEKIPEDGSLNTTK
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgggggctgctccggggcctgtggccgctgcacatcgtcctgtggacgcgcatc
gccagcacgatcccgccgcacgttcccaagtcggttaacagcgatctgatggcgggtgac
aacagcggtgcggtcaagcttccacagctgtgcaagttttgcgacgtgacactgtccact
tgtgacaaccagaagtcttgcatgagcaactgcagcgtcacctccatctgtgagaagccg
caggaagtctgcgtggccgtgtggaggaagaacgacaagaacattactctggagaccgtt
tgccacgaccccaagttcacctaccacggcttcactctggaagatgccacttctcccacg
tgcgtcatgaaggaaaagaaaagggcgggcgagaccttcttcatgtgctcctgtaacaca
gaggagtgtaacgattacatcatctttaatgaagaatacaccaccagcagtcctgacctg
ttgctggtcattatccaagtgacgggcgtcagcctcctgcctccgctggggattgccata
gctgtcattgccatcttctactgttaccgtgtccaccggcagcagaagttgagcccctcc
tgggagagcagcaagccccggaagctcatggatttcagcgacaactgcgccatcatcctg
gaggacgaccgctctgacatcagctctacgtgcgccaacaacatcaaccacaatacggaa
ctgctgcccatcgagctggacacgctggtggggaagggccgcttcgccgaggtctacaag
gccaagctgaagcagaacacttcagagcagtttgagaccgtggctgtcaagatcttcccc
tacgaggaatactcctcgtggaaaacggagaaggacatcttctctgacatcaacctgaaa
cacgagaacatcctgcagttcctgacggccgaggagcggaagacggagatgggcaagcag
tactggctgatcacggcgtttcatgctaagggcaacctgcaggagtacctcactaggcac
gtcatcagctgggaggacctgcggaagctgggcagctccctggcccggggcatcgcccat
ctgcacagtgaccacactccttgtgggaggcccaagatgcccattgttcacagggacctc
aagagctctaacatcctagtaagaagcgatctaacctgttgcctgtgtgacttcgggttg
tccttgggcctgagccctactctgtctgtggatgacctggccaacagcgggcaggtggga
acagcgagatacatggccccggaagttctagaatccaggatgaatttggagaacatggag
tccttcaagcagacggatgtctactccatggctctagtactctgggaaatgacgtcgcgc
tgcaacgctgtgggagaagtgaaagattatgagcccccgtttggttccagagtgcgggag
cacccctgtgtggagagcatgaaagacaacgtgctgagagaccgaggacggcctgaaatc
cccagcttctggctcaaccaccagggcatccagatcgtgtgtgagacactgaccgagtgc
tgggaccacgaccccgaggcccgtctcacagcccagtgtgtggcagagcgcttcagtgaa
ctggagcacccagatagactctccgggaggagctgctcccaggagaagattccagaagac
ggctccctgaacactaccaaatag

DBGET integrated database retrieval system