KEGG   Rattus norvegicus (rat): 81811
Entry
81811             CDS       T01003                                 

Gene name
Thpo
Definition
(RefSeq) thrombopoietin
  KO
K06854  thrombopoietin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04630  JAK-STAT signaling pathway
rno04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    81811 (Thpo)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    81811 (Thpo)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    81811 (Thpo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    81811 (Thpo)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  CSF and other factors
   81811 (Thpo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 81811
NCBI-ProteinID: NP_112395
RGD: 621438
Ensembl: ENSRNOG00000050172
UniProt: P49745
Position
11q23
AA seq 326 aa
MELTDLLLVAILLLTARLTLSSPVPPACDPRLLNKLLRDSYLLHSRLSQCPDVNPLSIPV
LLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRL
LLGALQGLLGTQLPPQGRTTAHKDPSALFLSLQQLLRGKVRFLLLVEGPALCVRRTLPTT
AVPSRTSQLLTLNKFPNRTSGLLETNFSVVARTAGPGLLNRLQGFRAKIIPGQLNQTSGS
LDQIPGYLNGTHEPVNGTHGLFAGTSLQTLEAPDVVPGAFNKGSLPLNLQSGLPPIPSLA
ADGYTLFPPSPTFPTPGSPPQLPPVS
NT seq 981 nt   +upstreamnt  +downstreamnt
atggagctgactgatttgctcctggtggccatacttctcctcaccgcaagactaactctg
tccagcccagttcctcccgcctgtgaccccagactcctaaataaactgcttcgtgactcc
tacctccttcacagccgactgagtcagtgtcctgacgtcaaccctttgtctatccctgtc
ctgctgcctgctgtggactttagcctgggagaatggaaaacccagacggaacagagcaag
gcacaggacattctaggggcagtgtcccttctactggagggggtgatggcagcacgagga
cagttggaaccctcctgcctctcatccctcctgggacagctttctggtcaggttcgcctc
ctcttgggagccctgcagggcctcctaggaacccagcttcctccacagggcaggaccaca
gctcacaaggaccccagtgccctcttcttgagcttgcaacaactgcttcggggaaaggtg
cgcttcctgctgctggtagaaggtcccgccctctgtgtcagacggacccttcccaccaca
gctgtcccaagcagaacctctcaactcctcacactaaacaagttcccaaacaggacttct
ggattgttggagacgaacttcagtgttgtagccagaactgctggccctggacttctgaac
aggcttcaaggattcagagccaagattattcctggtcagctaaatcaaacctccgggtcc
ttagaccaaatccctggatacctgaacgggacacacgaacctgtgaatggaactcatggg
ctctttgctgggacctcactacagaccctggaagccccagacgttgtgccaggagctttc
aacaaaggctccttgccactcaacctccagagtggacttcctcctatcccaagccttgct
gctgatggatacacacttttccctccttcacctaccttccccacccctgggtctccaccc
cagctcccccccgtttcctga

DBGET integrated database retrieval system