KEGG   Rattus norvegicus (rat): 81815Help
Entry
81815             CDS       T01003                                 

Gene name
Tpp2, TPP-2
Definition
(RefSeq) tripeptidyl peptidase 2
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    81815 (Tpp2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    81815 (Tpp2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     81815 (Tpp2)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S8: subtilisin family
   81815 (Tpp2)
Chaperones and folding catalysts [BR:rno03110]
 Intramolecular chaperones
  Subtilisin family
   81815 (Tpp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII
Motif
Other DBs
NCBI-GeneID: 81815
NCBI-ProteinID: NP_112399
RGD: 621584
Ensembl: ENSRNOG00000011194
UniProt: Q64560
Position
9q22
AA seq 1249 aa AA seqDB search
MATAATEEPFPFHGLLPKKETGASSFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDG
KPKIIDIIDTTGSGDVNTATEVEPKDGEITGLSGRVLKIPANWTNPSGKYHIGIKNGYDF
YPKALKERIQKERKEKIWDPIHRVALAEACRKQEEFDIANNGSSQANKLIKEELQSQVEL
LNSFEKKYSDPGPVYDCLVWHDGETWRACVDSNENGDLGKSTVLRNYKEAQEYGSFGTAE
MLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTR
LSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPNSGRICEVINEAVWKHNTIYVSSA
GNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYSLREKLPANQYTWSSRGPSADGAL
GVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALVLSGLKANNVDYTVHSVRR
ALENTAIKADNIEVFAQGHGIIQVDKAYDYLIQNTSFANRLGFTVTVGNNRGIYLRDPVQ
VAAPSDHGVGIEPVFPENTENSEKISFQLHLALTSNSSWVQCPSHLELMNQCRHINIRVD
PRGLREGLHYTEVCGYDIASPNAGPLFRVPITAVIAAKVNESSHYDLAFTDVHFKPGQIR
RHFVEVPEGATWAEVTVCSCSSEVSAKFVLHAVQLVKQRAYRSHEFYKFCSLPEKGTLIE
AFPVLGGKAIEFCIARWWASLSDVNIDYTISFHGIVCTAPQLNIHASEGINRFDVQSSLK
YEDLAPCITLKSWVQTLRPVNAKTRPLGSRDVLPNNRQLYEMVLTYSFHQPKSGEVTPSC
PLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYPHQYSLKLEKGDYTIRLQIRHEQISDL
DRLKDLPFIVSHRLSNTLSLDIHENHSLALLGKKKSSSLTLPPKYNQPFFVTSLPDDKIP
KGAGPGCYLAGSLTLSKTELGKKADVIPVHYYLIPPPTKTKNGSKDKEKDSEKEKDLKEE
FTEALRDLKIQWMTKLDSTDIYNELKETYPAYLPLYVARLHQLDAEKERMKRLNEIVDAA
NAVISHIDQTALAVYIAMKTDPRPDAATIKNDMDKQKSTLVDALCRKGCALADHLLHAQP
HDGAAAGDAEAKEEEGESTLESLSETYWETTKWTDLFDTKVLTFAYKHALVNKMYGRGLK
FATKLVEEKPTKENWKNCIQLMKLLGWTHCASFTENWLPIMYPPDYCVF
NT seq 3750 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgctgcgaccgaggagcctttccctttccatggtcttctaccaaagaaagag
actggggcctcctccttcctgtgccgctacccggagtatgacggacgcggggtgctcatc
gccgtcctggacacaggggttgatcccggggccccgggcatgcaggtcacgactgatggg
aaaccaaaaatcattgatatcattgatacaacaggaagtggtgatgtgaatactgctaca
gaagtagaaccaaaagatggcgaaatcactggtctttctggaagagtgcttaagattcct
gcaaactggacaaatccttcaggaaaatatcatattggcattaaaaatggttatgacttc
tatccaaaggctctcaaggaaaggatacagaaagaacggaaggaaaaaatctgggatcca
attcacagagttgcgcttgcagaagcttgtagaaaacaagaagaatttgatattgccaat
aatggctcttcccaagccaataaactaatcaaggaagagttgcagagtcaagtggaatta
cttaattcttttgagaaaaagtatagtgatccaggccctgtgtatgactgcttggtgtgg
catgatggtgagacctggagagcctgtgttgattcgaatgaaaatggggacttgggtaaa
tctactgtattgagaaactacaaagaggctcaagaatatggttcttttggcacagctgag
atgctgaattactctgttaatatttatgatgatggaaacctgctctccattgtgaccagt
ggaggagctcatggaacccatgtagcgagtatagctgctgggcattttccagaagagcct
gaacggaatggagttgctcctggtgctcaaattctatccattaagattggtgatacaagg
ctaagcaccatggaaacaggcacaggcctcatcagagctatgatagaagttataaatcat
aagtgtgatcttgtcaactacagttatggagaagcaactcattggccaaattctgggaga
atttgtgaagtaattaatgaagcagtatggaaacataatacaatttatgtttcaagtgct
ggaaataatggtccatgcctttctacagtgggttgtccaggaggaactacttccagcgtg
ataggtgttggagcttatgtttctcctgatatgatggttgcagagtattcactgagagag
aaactacctgcaaatcaatatacatggtcttctagaggcccaagtgctgatggggccctt
ggtgtgagcatcagtgcaccaggaggtgctattgcttctgtgcctaactggacattgagg
gggactcagctaatgaatgggacatcaatgtcttcccccaatgcctgtggtggcattgcc
ctggtactttcagggctgaaagcaaataatgttgactatactgttcactcagtcagaaga
gctctagaaaacactgcaataaaagctgacaatatagaagtatttgcccaaggacatgga
attattcaggttgacaaagcttatgactacctcattcagaatacatcatttgctaacaga
ttaggttttacagttacagttggaaataaccgtggcatctacctccgagatcctgttcag
gtggctgctccttcagatcatggtgttggcattgagcctgtatttccagagaacacagaa
aactctgaaaaaatatccttccagcttcatttagctttaacttcaaattcatcttgggtt
caatgtcccagccatttggaactcatgaatcaatgtcggcacataaacatacgtgtggac
cccaggggcttaagagaagggttacattatacagaggtatgtgggtatgatatagcatcc
cccaatgcaggtcctttattcagagttccaatcactgcagttatagcagcaaaagtaaat
gaatcatcacattatgatctagcctttacagatgtacattttaaacctggtcagattcga
agacattttgttgaggttcctgagggggcaacttgggctgaagttaccgtgtgttcgtgt
tcttctgaggtatcagcaaaatttgttcttcatgcagtacagcttgtgaagcagagagca
tatcgaagtcatgaattttataagttttgttcccttccagaaaaaggaacactcattgaa
gcctttcctgttctgggtgggaaagcaattgaattttgtattgctcgttggtgggcaagt
ctcagtgatgtcaatattgattataccatatcattccatggcatagtgtgtactgcacca
cagttaaacattcatgcatctgaaggaatcaatcgttttgatgtccagtcctctttaaaa
tatgaagatctggctccttgcataactttgaagagctgggtgcaaacactacgcccagta
aatgcaaaaaccagacctttaggatcaagagatgttttgccaaataatcgccagctttat
gagatggtcctgacatacagctttcatcagcccaagagcggagaagtaacacctagttgt
ccactcctttgtgaattattatatgagtcagaatttgacagtcagttgtggattattttt
gaccagaacaaaagacagatgggctcaggcgatgcctatccacatcagtattctttgaaa
ttggagaaaggagattatacgattcgattacagattcgtcatgagcaaatcagtgatttg
gatcgtctcaaagatcttccgtttattgtttcgcataggttgtctaataccttgagctta
gatattcatgaaaatcatagccttgcacttctaggaaagaagaaatcaagcagtttgaca
ttaccacccaaatataatcagccattctttgttacttccttacctgatgataaaatacct
aagggggcaggacccggatgctaccttgcaggctccttgacattgtcaaagactgagctt
ggaaagaaagctgatgtgatccctgttcattactatctaatacctccaccaacaaagact
aagaatggcagcaaagataaagaaaaggattcagaaaaagagaaagatttgaaagaagag
tttactgaagctttacgagatcttaaaattcagtggatgaccaagctggattctactgac
atttacaatgaattgaaagaaacatatcctgcttaccttcctttgtatgttgcacgtctt
catcaattagatgctgaaaaggagcggatgaaaagacttaatgaaattgttgatgctgcc
aatgctgttatttctcacatcgatcagaccgctctcgctgtttacattgccatgaagact
gaccccaggcctgatgcagctactataaaaaatgatatggacaagcagaaatctaccctg
gtagatgccctctgcaggaaaggatgtgctctggcagaccaccttcttcatgcacagccc
cacgatggggcagcagctggagatgcagaagcaaaagaagaggaaggagaaagtaccttg
gaatctctatcagaaacctattgggaaactacaaagtggacagatctttttgacactaag
gttttgacatttgcatacaagcatgcattagtaaataagatgtacgggagaggccttaag
tttgcaaccaaactcgtagaagaaaaaccaacaaaagaaaactggaaaaattgtattcaa
ctgatgaaattactcggatggacccattgtgcgtcttttactgaaaactggctccccatc
atgtatcctcctgattattgtgtattctaa

DBGET integrated database retrieval system