KEGG   Rattus norvegicus (rat): 81818
Entry
81818             CDS       T01003                                 

Gene name
Vim
Definition
(RefSeq) vimentin
  KO
K07606  vimentin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05169  Epstein-Barr virus infection
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    81818 (Vim)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    81818 (Vim)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    81818 (Vim)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    81818 (Vim)
   04147 Exosome [BR:rno04147]
    81818 (Vim)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     81818 (Vim)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     81818 (Vim)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   81818 (Vim)
  Exosomal proteins of other cancer cells
   81818 (Vim)
SSDB
Motif
Pfam: Filament Filament_head DUF4515 HALZ DUF1664 TPR_MLP1_2 DUF573 Laminin_II Golgin_A5 CENP-F_leu_zip
Other DBs
NCBI-GeneID: 81818
NCBI-ProteinID: NP_112402
RGD: 621646
Ensembl: ENSRNOG00000018087
UniProt: P31000
Position
17q12.3
AA seq 466 aa
MSTRSVSSSSYRRMFGGSGTSSRPSSNRSYVTTSTRTYSLGSALRPSTSRSLYSSSPGGA
YVTRSSAVRLRSSMPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDK
VRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAE
DIMRLREKLQEEMLQREEAESTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHDE
EIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSE
AANRNNDALRQAKQESNEYRRQVQSLTCEVDALKGTNESLERQMREMEENFALEAANYQD
TIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSS
LNLRETNLESLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgtccaccaggtccgtgtcctcgtcctcctaccgcaggatgttcggtggctccggcaca
tcgagccggcccagctccaaccggagctatgtgaccacatccacccgcacctacagccta
ggcagcgcgctgcgccccagcactagccgcagcctctattcctcgtccccgggtggcgcc
tatgtgacccggtcctccgccgtgcgcctgcggagcagcatgcccggcgtgcggctgctg
caggactccgtggacttctcgctggccgacgccatcaacaccgagttcaagaacacccgc
accaacgagaaggtggaattgcaggagctgaatgaccgcttcgccaactacatcgacaag
gtgcgcttcctcgagcagcagaacaaaatcctgctggccgagctcgagcagcttaagggc
cagggcaagtcgcgcctgggcgacctctacgaggaggagatgagggagttgcgccggcag
gtggatcagctcaccaatgacaaggcccgtgtcgaggtggagagggacaacctggccgag
gacatcatgcggctgcgagaaaaattgcaggaggagatgctccagagggaggaagccgag
agcaccctgcagtcattcagacaggatgttgacaatgcttctctggcacgtcttgacctt
gaacgtaaagtggaatccttgcaggaagaaattgcctttttgaagaagctgcacgatgaa
gagatccaggagctgcaggcccagattcaggaacagcatgtccagatcgatgtggacgtt
tccaagcctgacctcaccgctgccctgcgtgatgtccgccagcagtatgaaagtgtggct
gccaagaacctccaggaggccgaggaatggtacaagtccaagtttgctgacctctctgag
gctgccaaccggaacaacgatgccctgcgccaggcaaagcaggagtcaaacgaataccgg
agacaggtgcagtcactcacctgcgaagtggatgcccttaaaggcactaatgagtccctg
gagcgccagatgcgtgaaatggaagagaattttgcccttgaagctgctaactaccaggac
actattggccgcctgcaggatgagatccagaacatgaaggaagagatggctcgccacctt
cgtgaataccaggacctgctcaatgtaaagatggctcttgacattgagatcgccacctac
aggaagctgctggaaggggaggagagcaggatttctctgcctcttccaaacttttcttcc
ctgaacctgagagaaactaacctggagtcacttcctctggttgacacccactccaaaaga
acactcctgattaagacggttgaaaccagagacggacaggtgatcaatgagacttctcag
caccacgatgaccttgaataa

DBGET integrated database retrieval system