KEGG   Rattus norvegicus (rat): 81819
Entry
81819             CDS       T01003                                 

Gene name
Pax8
Definition
(RefSeq) paired box 8
  KO
K09293  paired box protein 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04918  Thyroid hormone synthesis
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    81819 (Pax8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    81819 (Pax8)
   05202 Transcriptional misregulation in cancer
    81819 (Pax8)
  09162 Cancer: specific types
   05216 Thyroid cancer
    81819 (Pax8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    81819 (Pax8)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Paired box domain only
    81819 (Pax8)
SSDB
Motif
Pfam: PAX Pax2_C HTH_23 HTH_32 HTH_Tnp_IS1 Ribosomal_S13_N HTH_38
Other DBs
NCBI-GeneID: 81819
NCBI-ProteinID: NP_112403
RGD: 620434
Ensembl: ENSRNOG00000026203
UniProt: P51974
Position
3p13
AA seq 457 aa
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSK
ILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDND
TVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTY
SINGLLGIAQPGSDNKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDTFGQHHLEPLECP
FERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVA
DPHSPYAIKQETPELSSSSSTPSSLSSSAFLDLQQVGSGGPAGASVPPFNAFSHAASVYG
QFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYSHTPYASY
SEAWRFPNSSLLSSPYYYSSTTRPSAPPTSATAFDHL
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgcctcacaactcgatcagatccggccacggagggctgaatcagttaggaggggctttt
gtgaatggcaggcctctgccagaagttgtccggcaacgcattgtggacttggcccaccag
ggagtgagaccctgtgatatctctcgccagcttcgtgtcagccatggctgtgtaagcaag
atccttggcaggtactacgagactggcagcatccggcctggagtgatagggggctccaag
cccaaggtggccacccccaaggtggtggagaagataggggactacaagcggcagaaccct
accatgtttgcttgggagatccgggaccggctcttggcagaaggcgtttgtgacaatgac
actgtgcccagtgtcagctccatcaacagaatcatccggaccaaagtgcagcagccattc
aacctccccatggacagctgcgtggccaccaaatctctgagcccaggacacacactgatc
cccagctcagctgtcacacccccagagtcaccccagtcggattccttgggctctacctac
tctatcaacgggctcctaggaattgctcagcctggcagtgacaacaagagaaagatggat
gatagtgaccaggacagttgtcgactgagcatcgattcccagagcagcagtagtggtcct
cgaaagcatcttcgtacagacaccttcgggcagcaccacctcgagccgctcgagtgcccg
tttgagcggcagcattacccggaggcctatgcctcccccagccacaccaaaggcgagcag
gggctatacccactgcccttactcaacagtaccctggatgacggaaaggccaccctgaca
ccttccaatacacctctgggacgcaacctctcaactcaccagacctaccctgtggtggca
gatcctcattcaccctacgccataaagcaggaaaccccagagctctccagttctagctcc
accccttcctctttatctagctccgcctttttggatctgcagcaagtcggctctgggggc
ccagcaggtgcctcggtcccacccttcaatgccttttcccatgctgcctccgtgtatggg
cagttcacgggccaggccctcctctcagggcgagagatggtggggcccacgctgcctgga
tacccaccccacatccccaccagtggacagggcagctatgcctcttccgctattgcaggc
atggtggcaggaagtgagtattctggcaatgcctacagccacaccccgtacgcctcctac
agtgaggcctggcgcttccccaactccagcctgctgagttccccatattattacagctct
acaacaaggccaagcgcaccgcccacctctgccacggcctttgaccatctgtag

DBGET integrated database retrieval system