KEGG   Rattus norvegicus (rat): 81825
Entry
81825             CDS       T01003                                 

Gene name
Cirbp
Definition
(RefSeq) cold inducible RNA binding protein
  KO
K13195  cold-inducible RNA-binding protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    81825 (Cirbp)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    81825 (Cirbp)
SSDB
Motif
Pfam: RRM_1 RRM_7 RRM_occluded PHM7_cyt
Other DBs
NCBI-GeneID: 81825
NCBI-ProteinID: NP_112409
RGD: 620756
Ensembl: ENSRNOG00000015999
UniProt: Q6NT88
Position
7q11
AA seq 172 aa
MASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDA
KDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGD
WGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE
NT seq 519 nt   +upstreamnt  +downstreamnt
atggcatcagatgaaggcaagcttttcgtgggaggtctcagcttcgacaccaatgagcag
gcgctggagcaggtcttctccaagtatgggcagatctcggaagtggtggtggtaaaggac
agggagactcaacgatcccgaggcttcgggtttgtcacctttgaaaatatcgatgacgct
aaggatgccatgatggctatgaatgggaagtctgtggatgggaggcagatccgagttgac
caggctggcaagtcttctgataaccggtcccgaggataccggggtggctctgctggaggc
cgtggcttcttccgtgggggacgcagccggggccgagggttctccagaggaggaggagac
tggggctatggaggtggccgctttgagtcccggagtggtggttatggaggctccagagac
tactatgccagccggagtcagggtggcagctatggctatcggagctccggtgggtcctac
agagacagctacgacagctatgctacacacaacgagtaa

DBGET integrated database retrieval system