KEGG   Rattus norvegicus (rat): 81826
Entry
81826             CDS       T01003                                 

Gene name
Slc20a1
Definition
(RefSeq) sodium-dependent phosphate transporter 1
  KO
K14640  solute carrier family 20 (sodium-dependent phosphate transporter)
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    81826 (Slc20a1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC20: Type III Na+-phosphate cotransporter
   81826 (Slc20a1)
SSDB
Motif
Pfam: PHO4 DUF2269
Other DBs
NCBI-GeneID: 81826
NCBI-ProteinID: NP_112410
RGD: 621079
Ensembl: ENSRNOG00000018567
UniProt: Q9JJP0
Position
3
AA seq 681 aa
MASTLAPITSTLAAVTASAPPKYDNLWMLILGFIIAFVLAFSVGANDVANSFGTAVGSGV
VTLKQACILASIFETVGSALLGAKVSETIRKGLIDVEKYNATQDLLMAGSVSAMFGSAVW
QLVASFLKLPISGTHCIVGATIGFSLVAKGQEGIKWSELIKIVMSWFVSPLLSGIMSGIL
FFLVRAFILRKADPVPNGLRALPIFYACTIGINLFSIMYTGAPLLGFDKLPLWGTILISV
GCAVFCALIVWFFVCPRMKRKIEREVKSSPSESPLMEKKNNLKDHEETKMAPGDVENRNP
VSEVVCATGPLRAVVEERTVSFKLGDLEEAPERERLPMDLKEETNIDGTINGAVQLPNGN
LVQFSQTVSNQINSSGHYQYHTVHKDSGLYKELLHKLHLAKVGDCMGDSGDKPLRRNNSY
TSYTMAICGMPLDSFRAKEGEQKGDEMETLTWPNADTKKRIRMDSYTSYCNAVSDLHSES
EMDMSVKAEMGLGDRKGSSGSLEEWYDQDKPEVSLLFQFLQILTACFGSFAHGGNDVSNA
IGPLVALYLVYETRDVTTKEATPIWLLLYGGVGICMGLWVWGRRVIQTMGKDLTPITPSS
GFSIELASAFTVVVASNIGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNIFMAWFVTV
PISGVISAAIMAVFKHIILPV
NT seq 2046 nt   +upstreamnt  +downstreamnt
atggcatctaccctggccccgattactagtactctagctgctgttactgcttctgctcca
ccgaagtatgacaatctgtggatgctcatcctgggcttcatcattgcatttgtcttggca
ttctccgtgggagccaatgatgtagcaaattcatttggtacagctgtaggctcaggtgta
gtgaccctgaagcaagcctgcatcctagctagcatcttcgaaactgtgggctccgccttg
ctgggggccaaagtgagtgaaaccatccggaagggcttgatagatgtggagaagtacaac
gcaactcaagatctgctcatggctggctctgtcagtgctatgtttggttctgctgtgtgg
caactagtggcttcgtttttgaagcttcctatttctgggacccattgtattgtcggtgca
accattggtttctcccttgtggcaaagggacaagagggtatcaaatggtccgaactgata
aaaattgtgatgtcttggttcgtctctccactgctttctggtattatgtctggaatttta
ttcttccttgttcgtgcattcatcctccgtaaggcagatccagttcctaatggcttacga
gctttacccattttttatgcctgcacaattggaatcaacctcttttccattatgtatact
ggagcaccattgctgggctttgacaaacttcctctgtggggtaccatcctcatctcggtg
ggatgtgcagttttctgtgcccttatcgtctggttctttgtatgtcccaggatgaagagg
aaaattgaacgagaagtaaagtctagtccctctgaaagtcccttaatggaaaagaagaac
aacttaaaagaccatgaagaaacaaagatggctcctggcgatgttgagaataggaatcct
gtgtctgaggtagtatgtgccactggcccactacgggctgtggtggaggagagaacggtg
tcatttaaactcggtgacctggaggaagctccggagcgagagcggcttcccatggacctg
aaggaggagaccaacatagatggtactatcaatggtgcagtgcagttgcctaatgggaac
cttgttcagttcagtcaaaccgtcagcaaccagatcaactccagtggccactatcagtat
cacaccgtgcacaaggattctggcttgtacaaagagctgctccataagctacatctggcc
aaggtgggagactgcatgggagactctggggacaagcccttgagacgcaacaacagctac
acatcctacaccatggcaatatgtggcatgcccctggattccttccgtgccaaagaaggg
gaacaaaagggagacgaaatggaaacgctgacttggcctaatgcagataccaagaagcgg
attcggatggacagttacaccagttactgcaatgctgtgtctgaccttcactcagagtct
gagatggacatgagtgttaaggcagagatgggtctgggtgacagaaaaggaagcagtggc
tctcttgaagaatggtatgatcaggataagcctgaagtgtcccttctcttccagtttctg
cagatccttacagcctgctttgggtcctttgcccatggtggcaatgacgtcagcaatgcc
atcggccctctggttgctttgtatcttgtttatgaaacgagagatgtcactacaaaagag
gcaacacccatatggcttctgctttatggtggtgttggcatttgcatggggctatgggtt
tggggaagaagagttatccagactatggggaaggacctgacaccaatcacaccctccagt
ggtttcagtattgaactggcatctgccttcactgtggtcgtcgcatcaaacattggcctt
cccatcagcacaacacattgtaaggtgggctctgtggtgtctgttggctggctccgatcc
aagaaggctgttgactggcgactgtttcgaaacatttttatggcctggtttgtcaccgtc
cctatttctggggttatcagtgctgctatcatggcagtgttcaagcacatcattctgccg
gtgtga

DBGET integrated database retrieval system