KEGG   Rattus norvegicus (rat): 81829
Entry
81829             CDS       T01003                                 

Gene name
Mdh2
Definition
(RefSeq) malate dehydrogenase, mitochondrial precursor
  KO
K00026  malate dehydrogenase [EC:1.1.1.37]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00020  Citrate cycle (TCA cycle)
rno00270  Cysteine and methionine metabolism
rno00620  Pyruvate metabolism
rno00630  Glyoxylate and dicarboxylate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
Module
rno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rno_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    81829 (Mdh2)
   00620 Pyruvate metabolism
    81829 (Mdh2)
   00630 Glyoxylate and dicarboxylate metabolism
    81829 (Mdh2)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    81829 (Mdh2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     81829 (Mdh2)
SSDB
Motif
Pfam: Ldh_1_C Ldh_1_N Semialdhyde_dh 3Beta_HSD THF_DHG_CYH_C NAD_binding_10 DapB_N
Other DBs
NCBI-GeneID: 81829
NCBI-ProteinID: NP_112413
RGD: 619719
Ensembl: ENSRNOG00000001440
UniProt: P04636
Position
12
AA seq 338 aa
MLSALARPVGAALRRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAH
TPGVAADLSHIETRANVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATI
VATLTAACAQHCPEAMICIISNPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTF
VAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLATLTGRIQEAGTEVVKA
KAGAGSATLSMAYAGARFVFSLVDAMNGKEGVIECSFVQSKETECTYFSTPLLLGKKGLE
KNLGIGKITPFEEKMIAEAIPELKASIKKGEDFVKNMK
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgctgtccgctctcgcccgtcctgtcggtgccgctctccgccgcagcttcagcacttca
gcccagaacaatgctaaagtagctgtcctgggagcttctgggggcattgggcaacccctt
tcactcctcctgaagaacagtcccctcgtgagccgcctgaccctctatgacatcgctcac
acacctggtgtggcagcagatctgagtcacatcgagaccagagcaaatgtgaaaggctac
ctcgggccggagcagctgccggactgcctaaaaggttgtgatgttgtggtcatcccagct
ggagtgcccaggaagccaggaatgacacgagatgacctgttcaacaccaatgctaccatt
gtggccacattgacggctgcctgtgcccagcactgtcctgaagccatgatttgcatcatt
tccaacccagttaactccaccatccccatcacagccgaagttttcaagaagcatggcgta
tacaaccccaacaagatattcggtgtgacaacccttgacatcgtcagagcaaacacattt
gtggcagagctaaagggtttggacccagctcgagtcaatgtgcctgtcattggtggccac
gccgggaagacgatcatccccctgatctctcagtgtacccccaaggttgactttccccaa
gaccagctggccacactcaccgggaggatccaggaggctggcactgaagtcgtgaaggcc
aaggctggagcaggctctgccactctgtccatggcttatgctggagcccgctttgtcttc
tccctggtggacgccatgaatgggaaggaaggagtcatcgagtgctcttttgttcagtcc
aaagagacagagtgcacttatttctctacacccttgctgttggggaaaaaaggcctggag
aagaacctaggcattggcaaaatcactccttttgaggagaaaatgattgccgaggccatc
cctgagctgaaagcctccatcaagaaaggcgaggactttgtgaagaacatgaagtga

DBGET integrated database retrieval system