KEGG   Rattus norvegicus (rat): 81859
Entry
81859             CDS       T01003                                 

Gene name
Sharpin, Conneck1
Definition
(RefSeq) SHANK-associated RH domain interactor
  KO
K20894  shank-associated RH domain-interacting protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    81859 (Sharpin)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    81859 (Sharpin)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    81859 (Sharpin)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   LUBAC complex
    81859 (Sharpin)
SSDB
Motif
Pfam: Sharpin_PH zf-RanBP ubiquitin
Other DBs
NCBI-GeneID: 81859
NCBI-ProteinID: NP_112415
RGD: 631353
Ensembl: ENSRNOG00000012812
UniProt: Q9EQL9
Position
7q34
AA seq 381 aa
MSPPAGGAAAAADPASPVVLLAVQAAVRLLGAGHEDEAQLRKLQLKADPERPGRFRLGLL
GIEPGAVSLEWPLESICYTIRGPNQHELQPPPGGPGTFSVHFLNSEEAQQWAALVRDATA
EGQNGNDSTAPVPTPAMCPTSPPCSSVTPTPKATQPEMDLPQGSGNLKKEELATHLAQAI
AGGDEKAAAQVAAILAQHHVALNVQLLEAWFPRGPIRLQVTVEDATSVLSSSSSAHVSLQ
IHPHCSIAALQEQVFSEFGFPPAVQRWVIGRCLCMPERSLASYGVSQDGDPAFLYLLSAP
REVSGHSPQHSKMDRKLGCLFPQSLELPHNLQASSSSLPSPPQPGWSCPSCTFINASNRP
GCEMCSTQRPCAWDPLTATST
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgtcgccgcccgccggcggtgcggcagcggctgcagaccctgcttcacctgtggtgctc
ctggcagtgcaagccgcggtgagactcctgggcgccggacatgaagacgaagcgcagctg
cgaaagctgcagttgaaagccgaccctgagcggcctggacgcttccggctgggactgtta
ggcattgagccaggggcggtcagtttagaatggcccttggagtctatttgctataccatt
cgtggtcctaaccaacacgagctgcagcctccacctggaggtcctggaaccttcagtgtg
cacttcctcaactctgaggaagcacagcagtgggcagcactggtgcgagatgccaccgca
gaaggacaaaatggcaatgacagcacagccccagtcccaaccccagccatgtgccccact
tctccaccatgttcttctgtgactccaacacctaaagcaacccaaccagagatggacctt
cctcaaggttctggaaacttgaaaaaagaagagctggctacacacctggcccaggccatt
gcaggtggggatgagaaagcagcagcccaagtggcggcaatcctggcacagcatcatgtg
gctctcaatgtccagctcttagaggcctggttcccacggggtcccataaggctgcaagtc
acagttgaagatgccacatcggttttatcctcttcgtcgtctgcccatgtctcactgcag
atccacccacactgttccattgcagccctccaggaacaggtgttctcagagttcggtttc
ccaccagctgtgcagcgctgggtcattggccggtgcctgtgtatgcctgaacgaagcctt
gcttcctatggggtctctcaagatggggaccctgcttttctttacttgctctcagccccc
cgagaagtttcaggacacagccctcaacactccaagatggataggaaattaggatgcttg
tttcctcagtcattggagctgcctcataacctccaggcatccagttccagtctcccaagt
ccccctcagcctggctggtcttgcccttcctgcaccttcatcaatgcttcaaaccgccct
ggctgtgagatgtgtagcacccaaaggccctgtgcttgggatccccttactgcaacttcc
acctag

DBGET integrated database retrieval system