KEGG   Rattus norvegicus (rat): 81869
Entry
81869             CDS       T01003                                 
Symbol
Gstm7
Name
(RefSeq) glutathione S-transferase Mu 7
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis - DNA adducts
rno05207  Chemical carcinogenesis - receptor activation
rno05208  Chemical carcinogenesis - reactive oxygen species
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    81869 (Gstm7)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    81869 (Gstm7)
   00982 Drug metabolism - cytochrome P450
    81869 (Gstm7)
   00983 Drug metabolism - other enzymes
    81869 (Gstm7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    81869 (Gstm7)
   05204 Chemical carcinogenesis - DNA adducts
    81869 (Gstm7)
   05207 Chemical carcinogenesis - receptor activation
    81869 (Gstm7)
   05208 Chemical carcinogenesis - reactive oxygen species
    81869 (Gstm7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    81869 (Gstm7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    81869 (Gstm7)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    81869 (Gstm7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    81869 (Gstm7)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     81869 (Gstm7)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   81869 (Gstm7)
SSDB
Motif
Pfam: GST_N GST_C_3 GST_C GST_C_6 GST_N_3 GST_C_2 Bromo_TP GST_N_2
Other DBs
NCBI-GeneID: 81869
NCBI-ProteinID: NP_112416
RGD: 621287
Ensembl: ENSRNOG00000018937
UniProt: P08009
Position
2:complement(195566701..195572149)
AA seq 218 aa
MPMTLGYWDIRGLAHAIRLLLEYTDSSYEEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNL
PYLIDGSHKITQSNAILRYLGRKHNLCGETEEERIRVDILENQLMDNRMVLARLCYNPDF
EKLKPGYLEQLPGMMRLYSEFLGKRPWFAGDKITFVDFIAYDVLERNQVFEATCLDAFPN
LKDFIARFEGLKKISDYMKSSRFLPRPLFTKMAIWGSK
NT seq 657 nt   +upstreamnt  +downstreamnt
atgcccatgacactgggttactgggacatccgtgggctagcgcatgccatccgcctgctc
ctggaatacacagactcgagctatgaggagaagagatacaccatgggagacgctcccgac
tttgacagaagccagtggctgaatgagaagttcaaactgggcctggacttccccaatctg
ccctacttaattgatgggtcacacaagatcacccagagcaacgccatcctgcgctatctt
ggccgcaagcacaacctgtgtggggagacagaagaggagaggattcgtgtggacattctg
gagaatcagctcatggacaaccgcatggtgctggcgagactttgctataaccctgacttt
gagaagctgaagccagggtacctggagcaactgcctggaatgatgcggctttactccgag
ttcctgggcaagcggccatggtttgcaggggacaagatcacctttgtggatttcattgct
tacgatgttcttgagaggaaccaagtgtttgaggccacgtgcctggacgcgttcccaaac
ctgaaggatttcatagcgcgctttgagggcctgaagaagatctccgactacatgaagtcc
agccgcttcctcccaagacctctgttcacaaagatggctatttggggcagcaagtag

DBGET integrated database retrieval system