KEGG   Rattus norvegicus (rat): 81918
Entry
81918             CDS       T01003                                 

Gene name
Pard3
Definition
(RefSeq) partitioning defective 3 homolog
  KO
K04237  partitioning defective protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04062  Chemokine signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04144  Endocytosis
rno04360  Axon guidance
rno04390  Hippo signaling pathway
rno04520  Adherens junction
rno04530  Tight junction
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    81918 (Pard3)
   04390 Hippo signaling pathway
    81918 (Pard3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    81918 (Pard3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    81918 (Pard3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    81918 (Pard3)
   04530 Tight junction
    81918 (Pard3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    81918 (Pard3)
  09158 Development and regeneration
   04360 Axon guidance
    81918 (Pard3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    81918 (Pard3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    81918 (Pard3)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     81918 (Pard3)
SSDB
Motif
Pfam: Par3_HAL_N_term PDZ PDZ_6 PDZ_2 TSGP1
Other DBs
NCBI-GeneID: 81918
NCBI-ProteinID: NP_112514
RGD: 620374
Ensembl: ENSRNOG00000032437
UniProt: Q9Z340
Structure
PDB: 

Position
19
AA seq 1337 aa
MKVTVCFGRTRVVVPCGDGRMKVFSLIQQAVTRYRKAVAKDPNYWIQVHRLEHGDGGILD
LDDILCDVADDKDRLVAVFDEQDPHHGGDGTSASSTGTQSPEIFGSELGTNNVSAFRPYQ
TTSEIEVTPSVLRANMPLHVRRSSDPALTGLSTSVSDNNFSSEEPSRKNPTRWSTTAGFL
KQNTTGSPKTCDRKKDENYRSLPRDPSSWSNQFQRDNARSSLSASHPMVDRWLEKQEQDE
EGTEEDSSRVEPVGHADTGLENMPNFSLDDMVKLVQVPNDGGPLGIHVVPFSARGGRTLG
LLVKRLEKGGKAEQENLFHENDCIVRINDGDLRNRRFEQAQHMFRQAMRARVIWFHVVPA
ANKEQYEQLSQREMNNYSPGRFSPDSHCVANRSVANNAPQALPRAPRLSQPPEQLDAHPR
LPHSAHASTKPPTAPALAPPNVLSTSVGSVYNTKRVGKRLNIQLKKGTEGLGFSITSRDV
TIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLAGKSQEEVVSLLRSTKMEGTV
SLLVFRQEEAFHPREMNAEPSQMQSPKETKAEDEDIVLTPDGTREFLTFEVPLNDSGSAG
LGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKANQEAME
TLRRSMSTEGNKRGMIQLIVARRISRCNELRSPGSPAAPELPIETELDDRERRISHSLYS
GIEGLDESPTRNAALSRIMGESGKCQLSPTVNMPHDDTVMIEDDRLPVLPPHLSDQSSSS
SHDDVGFIMTEAGTWAKATISDSADCSLSPDVDPVLAFQREGFGRQSMSEKRTKQFSNAS
QLDFVKTRKSKSMDLGIADETKLNTVDDQRAGSPNRDVGPSLGLKKSSSLESLQTAVAEV
TLNGNIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPMVDDDDEGMETLEEDTEESSRSGR
ESVSTSSDQPSYSLERQMNGDPEKRDKAEKKKDKAGKDKKKDREKEKDKLKAKKGMLKGL
GDMFRFGKHRKDDKMEKMGRIKIQDSFTSEEDRVRMKEEQERIQAKTREFRERQARERDY
AEIQDFHRTFGCDDELLYGGMSSYDGCLALNARPQSPREGHLMDTLYAQVKKPRSSKPGD
SNRSTPSNHDRIQRLRQEFQQAKQDEDVEDRRRTYSFEQSWSSSRPASQSGRHSVSVEVQ
VQRQRQEERESFQQAQRQYSSLPRQSRKNASSVSQDSWEQNYAPGEGFQSAKENPRYSSY
QGSRNGYLGGHGFNARVMLETQELLRQEQRRKEQQLKKQPPADGVRGPFRQDVPPSPSQV
ARLNRLQTPEKGRPFYS
NT seq 4014 nt   +upstreamnt  +downstreamnt
atgaaagtgaccgtgtgcttcgggaggacccgggtggtcgtgccgtgcggagatggccgc
atgaaagttttcagccttatccagcaggcggtgacccgctaccggaaggccgtggccaag
gatccaaactactggatacaggtacatcgcttggagcatggggacggtgggattctagac
ctggatgacatcctctgtgacgttgccgatgacaaagacagactggtagcagtgtttgat
gagcaggatccccaccatggaggagatggtacgagtgccagctccacgggaacccagagt
ccagagatattcggcagtgagctgggcaccaacaatgtttctgcttttcggccttatcaa
accacaagtgaaattgaggtcacgccttcagtccttcgggcaaatatgcctcttcacgtc
cgacggagcagtgacccagctttaactggcctatccacttccgtcagtgataacaacttt
tcctcagaggagccctccaggaaaaaccccacccgctggtccacgacagctggctttctc
aagcagaacaccactggaagtcccaaaacctgcgacaggaagaaagatgaaaactacagg
agcctcccacgggatcccagtagctggtccaaccagttccagagagacaacgcccgctcc
tctctgagtgccagccacccaatggtagaccggtggctggagaagcaagaacaggacgag
gaaggcacagaagaagacagcagccgagtggagccggttggacatgctgatactggactg
gagaatatgcccaacttttccctcgatgatatggtaaagctcgtacaagtccccaacgat
ggagggcccctgggaatccatgtagtgcctttcagtgctcgaggcggcagaacactgggg
ttgttagtgaagcggttggagaaaggtgggaaggctgaacaagaaaaccttttccacgag
aatgactgcattgtgaggattaacgatggagatcttcgaaacagaagatttgagcaagca
cagcatatgttccgccaagccatgcgtgcgcgagtcatttggttccacgtggtccctgca
gcgaacaaggagcagtatgaacagctctcccaacgagagatgaacaactattcccctggc
cgcttcagccccgacagccactgtgtggccaacaggagtgtggccaacaatgcgcctcag
gcgttgcccagagcacccagactgagccagccacctgagcagctggatgctcacccccga
ctacctcatagtgctcatgcctcaaccaaaccgcccacagccccagccttggctccaccg
aatgtgcttagtaccagtgtcggcagtgtgtacaacacgaagagagtaggcaagaggctc
aacattcagcttaaaaaaggtacagaaggactgggatttagcatcacttcccgagacgta
actataggtggctcagctcccatttatgtcaagaacattcttcctcgaggggctgccatt
caggatggcaggctcaaggcgggagaccggctaatagaggtcaatggagtagatttagcg
ggcaagtcccaggaggaagttgtttccctgttgagaagcaccaagatggaggggaccgtg
agccttctggtctttcgtcaagaagaggctttccacccaagggaaatgaatgccgaaccc
agccagatgcagagtccaaaagaaacgaaagccgaagacgaggacattgttctcacacct
gacggtaccagggagtttctgactttcgaagttccactgaatgactcagggtctgcaggg
cttggtgtcagcgtcaaggggaaccgctccaaagagaaccatgcagatttggggatcttc
gttaagtccatcattaacgggggagctgcatctaaagatgggaggctgagggtaaatgac
cagctgatagctgtgaacggagagtctctgctgggcaaagccaaccaggaagccatggag
actctgaggaggtccatgtccaccgagggcaacaagcgtggcatgatccagctcatcgtg
gcgaggcggatcagcagatgtaacgagttgcggtctcctgggagccccgctgcacccgag
ctgcccatagaaacagagttggatgacagagaacgcaggatctcacactccctctacagt
gggatcgaggggctggatgagtctcccaccaggaatgccgcactcagcaggataatgggt
gagtcaggtaaatgccagctctccccaaccgtgaacatgccacatgatgacactgtcatg
attgaagatgacaggctgcctgtgctccctcctcacctctctgaccagtcctcctccagc
tcccatgatgacgtgggattcataatgacagaagcaggcacgtgggccaaggctaccatc
agtgactcagccgactgctcattgagtccagatgttgatccggttctcgcttttcaacga
gaaggatttggacgccagagtatgtcagaaaaacgcacaaagcaattttcaaatgccagt
caattggatttcgttaaaacacgaaaatcaaaaagcatggatttaggtatagctgacgag
actaaactcaatacagtggatgaccagagagcaggctcccccaatagagatgtgggaccc
tccttgggtctgaagaaatccagctctttagaaagtctgcagacggctgttgctgaggtg
accctgaatgggaacattcctttccaccgcccacggccacgaatcatccgaggaaggggc
tgcaacgagagcttcagagccgccattgacaagtcctacgataagcccatggtggatgac
gacgacgaaggcatggagaccttggaagaagacacagaagaaagttcaaggtcagggagg
gagtccgtgtccacgtccagtgatcagccttcctattctctggagagacaaatgaatgga
gacccagagaagagggacaaggcagagaagaaaaaggacaaagccggaaaggataagaag
aaagaccgagagaaggagaaggataaactgaaagccaagaaggggatgctgaaaggcttg
ggggacatgttcaggtttggcaaacatcgaaaagatgacaagatggaaaaaatgggtcga
ataaaaatccaggactctttcacctcagaagaggacagggtgcggatgaaggaggaacag
gagaggattcaagccaaaactcgagaatttagggagcggcaagctcgagagcgcgactat
gctgaaatccaagatttccatcgaacatttggctgtgatgacgagttgctgtatgggggc
atgtcatcctatgatggctgcctggctctcaatgccagaccccagagcccaagagaaggt
cacctgatggacactttgtatgcacaagtaaagaaacctcggagctccaaacctggggac
agcaatcgatccacccctagcaaccatgaccggatacaacgtctacggcaagaattccag
caagccaaacaggatgaggacgtggaagaccggcgccgtacctacagctttgagcaatct
tggtccagctcacggccagcatcgcagagtggtcggcactcggtgtcagtggaggttcaa
gtgcagcggcagcgccaggaggagcgagagagcttccagcaggcccagcgccagtacagc
tccctgccaagacaaagcaggaagaatgccagctctgtatcacaggattcctgggaacag
aactacgcccctggtgaaggcttccagagtgccaaggagaaccccaggtattccagttac
cagggctccaggaacggctatctaggtggccatggctttaatgccagggtcatgctggag
acccaggagcttctccgacaggagcagaggcgaaaagagcagcaactgaagaagcagcca
ccagcggatggagtcagagggcccttccggcaagatgtacccccgtctccatctcaggtg
gccaggctgaacagactgcagacacccgagaaagggcggcccttctactcctga

DBGET integrated database retrieval system