KEGG   Rattus norvegicus (rat): 81919Help
Entry
81919             CDS       T01003                                 

Gene name
Fut1, Futa
Definition
(RefSeq) fucosyltransferase 1
  KO
K00718  galactoside 2-L-fucosyltransferase 1/2 [EC:2.4.1.69]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00601  Glycosphingolipid biosynthesis - lacto and neolacto series
rno00603  Glycosphingolipid biosynthesis - globo and isoglobo series
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    81919 (Fut1)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    81919 (Fut1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    81919 (Fut1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    81919 (Fut1)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.69  type 1 galactoside alpha-(1,2)-fucosyltransferase
     81919 (Fut1)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  ABO blood group
   81919 (Fut1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Others
   Fucosyltransferase
    81919 (Fut1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_11 O-FucT
Motif
Other DBs
NCBI-GeneID: 81919
NCBI-ProteinID: NP_112515
RGD: 2638
Ensembl: ENSRNOG00000020995
UniProt: Q10980
Position
1q22
AA seq 376 aa AA seqDB search
MWTPSRKQLCLAFLSVCVLSAGSFFFHLNGGNFFQNALTFSVLCPDYHLLKSPVAMVCLP
YPSNASSGSPSCPEQSLLSGTWTITPGGRFGNQMGQYATLLALAQLNGRRAFIQPEMHTT
LAPVFRISLPVLDPEVDSLTPWQHLVLHDWMSEEYSHLEDPFLKLSGFPCSWTFFHHLRE
QIRREFTLHDHLREDAQRLLSGLRIGPAGIRPRTYVGVHVRRGDYLEVMPNRWKGVVGDR
AYLQKAMDWFRARHKDPIFVVTSNGMRWCLENIDTSHGDVVFAGNGQEGTPGKDFALLTQ
CNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFRPKAAFLPEWVGINADLSPL
QAQFDPWETDSLFRLA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtggactcccagccggaagcagctctgcctggcatttctgtcggtctgtgtgctctct
gccggctccttcttcttccacctgaatggaggaaacttctttcaaaatgctctaactttc
tctgtcctgtgtccagactatcacctgctgaagtccccagtggccatggtatgcctacct
tatccgtcgaacgcatccagtggctccccttcctgtcccgagcagtccttgctctctggg
acttggacaatcacccccggaggcaggtttggtaaccagatgggacagtatgccacattg
ctggccctagcccagctcaatggccgccgggctttcatccagcctgagatgcataccacc
ctggcccctgtgttccgaatctccctgccagtgctggaccctgaggtggacagtctcacg
ccttggcagcacttagtcctacatgactggatgtcagaggagtactcccacctggaggac
ccgtttctcaagctgtctggtttcccctgctcttggacctttttccatcacctccgggaa
cagattcgccgggaattcaccctgcatgaccacctacgggaagacgcacagcgcctgttg
agtgggctccggataggccctgcaggcatccgtcctcgtacctatgtgggtgttcacgtg
cgtcgtggagactatttggaggtgatgcctaaccgctggaagggagtggtgggtgaccga
gcttacctccagaaagccatggactggttccgggcccggcacaaagaccccatctttgtg
gtcaccagcaatggcatgagatggtgtttggagaacattgacacatcccacggtgatgtg
gtcttcgctggcaatggacaggagggtacgccggggaaggacttcgcactgctcacccag
tgtaatcacaccatcatgactattgggacctttggcttctgggctgcctacctggctggt
ggagacactgtctaccttgctaacttcacccttccagattcagagtttctgaagatcttc
aggcctaaggctgccttcctgcccgagtgggtgggcattaacgcagacttgtccccgctg
caggctcagtttgacccctgggagacagacagtctttttagactggcttga

DBGET integrated database retrieval system