KEGG   Rattus norvegicus (rat): 81922Help
Entry
81922             CDS       T01003                                 

Gene name
Sh3gl1, SH3P8
Definition
(RefSeq) SH3 domain-containing GRB2-like 1
  KO
K11247  endophilin-A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    81922 (Sh3gl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    81922 (Sh3gl1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    81922 (Sh3gl1)
  Bin/Amphiphysin/Rvs (BAR) family proteins
   N-BAR proteins
    81922 (Sh3gl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAR SH3_1 SH3_9 BAR_2 SH3_2 BAR_3 Prefoldin_3
Motif
Other DBs
NCBI-GeneID: 81922
NCBI-ProteinID: NP_112518
RGD: 708456
Ensembl: ENSRNOG00000049683
UniProt: O35964
Structure
PDB: 

Position
9q12
AA seq 368 aa AA seqDB search
MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFREMEKKVDITSKAVAEVLVRTIEYLQP
NPASRAKLTMLNTVSKIRGQVKNPGYPQSEGLLGECMVRHGKELGGESNFGDALLDAGES
MKRLAEVKDSLDIEVKQNFIDPLQNLCDKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPD
EELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILEELADKL
KRRVREASSRPRREFKPRPQEPFELGELEQPNGGFPCASAPKITASSSFRSGDKPTRTPS
KSMPPLDQPSCKALYDFEPENDGELGFREGDLITLTNQIDENWYEGMLHGQSGFFPLSYV
QVLVPLPQ
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtggcggggctgaagaagcagttctacaaggcgagccagctggtcagcgagaaa
gttggtggggccgaagggaccaaactggatgatgacttcagagagatggaaaagaaagtg
gatatcaccagtaaggccgtggcagaggtgctggtcagaaccatagaatatctgcaacct
aacccagcctcgagggccaagctgactatgctgaatactgtatccaagatccggggccaa
gtgaagaatcctggctacccacagtcagagggtctgctgggagagtgcatggtccgccat
ggcaaggaactaggcggagagtccaactttggcgatgctctgctagatgcaggtgagtct
atgaagcgcctggctgaggtgaaggactcactggacatcgaggtcaagcagaacttcatc
gacccactgcagaacctgtgtgacaaggatctgaaggagatccagcaccacctgaagaag
ttggagggccgccgccttgactttgactacaagaagaagcgccagggcaagatccctgat
gaggagctgcgtcaggccctagagaagtttgaggagtccaaggaggtggcggagaccagt
atgcacaacctcctggagactgatattgagcaggtgagccagctctcagccctagtggat
gcccagctggactaccaccggcaggcagtgcagatcctggaggagctggctgataagctg
aagcgcagggtgagagaagcctcctcacgccccaggagggagttcaagcccaggccccag
gagccctttgagcttggagagctggagcagcccaatgggggattcccctgtgcctcagca
cccaagatcacagcttcgtcatcatttagatcaggggacaagcccaccaggacgcccagc
aagagtatgccacccctggaccagccaagctgcaaggcgctgtatgactttgagccagag
aacgatggcgagctgggcttccgagagggtgacctcatcacgcttaccaaccagatcgat
gagaactggtatgaggggatgctgcatggccagtcaggcttcttcccacttagctatgtg
caggtgctggtgcctctgcctcagtga

DBGET integrated database retrieval system