KEGG   Rattus norvegicus (rat): 83462
Entry
83462             CDS       T01003                                 

Gene name
Dynlt1, AGS2, Tctex1
Definition
(RefSeq) dynein light chain Tctex-type 1
  KO
K10420  dynein light chain Tctex-type 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    83462 (Dynlt1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    83462 (Dynlt1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     83462 (Dynlt1)
SSDB
Motif
Pfam: Tctex-1 P22_AR_C
Other DBs
NCBI-GeneID: 83462
NCBI-ProteinID: NP_112608
RGD: 620261
Ensembl: ENSRNOG00000018207
UniProt: Q9Z336 B2RYR9
Position
1q11
AA seq 113 aa
MEDFQASEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKP
FKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI
NT seq 342 nt   +upstreamnt  +downstreamnt
atggaagacttccaggcctccgaggagactgcatttgttgtggatgaagtgagcaacatt
gtaaaggaggctatagaaagtgccatcggcggtaacgcctaccagcacagcaaagtcaac
cagtggaccactaatgttgtagaacagactttgagccaactcaccaaactggggaaacca
tttaaatacattgtgacctgtgtgatcatgcagaagaatggtgctgggttacacaccgca
agttcctgcttctgggacagctccacggacgggagctgcacagtccgatgggagaacaag
accatgtactgcatcgtcagtgccttcggactgtccatctga

DBGET integrated database retrieval system