KEGG   Rattus norvegicus (rat): 83471
Entry
83471             CDS       T01003                                 

Symbol
Prep
Name
(RefSeq) prolyl endopeptidase
  KO
K01322  prolyl oligopeptidase [EC:3.4.21.26]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    83471 (Prep)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    83471 (Prep)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.26  prolyl oligopeptidase
     83471 (Prep)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S9: prolyl oligopeptidase family
   83471 (Prep)
SSDB
Motif
Pfam: Peptidase_S9_N Peptidase_S9 Esterase Hydrolase_4
Other DBs
NCBI-GeneID: 83471
NCBI-ProteinID: NP_112614
RGD: 620841
Ensembl: ENSRNOG00000051061
UniProt: O70196
Position
20
AA seq 710 aa
MLSFQYPDVYRDETSVQDYHGHKICDPYAWLEDPDSEQTKAFVEAQNKITVPFLEQCPIR
GLYKERMTELYDYPKYSCHFKKGKRYFYFYNTGLQNQRVLYVQDSLEGEARVFLDPNTLS
DDGTVALRGYAFSEDGEYFAYGLSASGSDWVTIKFMKVDGAKELPDVLERVKFTCMAWTH
DGKGMFYNSYPQQDGKSDGTETSTNLHQKLCYHVLGTDQSEDVLCAEFPDEPKWMGGAEL
SDDGRYVLLSIWEGCDPVNRLWYCDLQQGSNGINGILKWVKLIDNFEGEYDYITNEGTVF
TFKTNRNSPNYRLINIDFTDPDESKWKVLVPEHEKDVLEWVACVRSNFLVLCYLRNVKNI
LQLHDLTTGALLKTFPLDVGSVVGYSGRKKDSEIFYQFTSFLSPGVIYHCDLTREELEPR
VFREVTVKGIDASDYQTIQVFYPSKDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISI
TPNYSVSRLIFVRHMGGVLAVANIRGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKE
GYTTSKRLTINGGSNGGLLVAACANQRPDLFGCVIAQVGVMDMLKFHKFTIGHAWTTDYG
CSDSKQHFEWLLKYSPLHNVKLPEADDIQYPSMLLLTADHDDRVVPLHSLKFIATLQYIV
GRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIEWIQ
NT seq 2133 nt   +upstreamnt  +downstreamnt
atgctgtccttccagtaccctgacgtgtaccgcgacgagacctcagtacaggattatcat
ggacataaaatttgcgacccttatgcttggcttgaagacccagacagtgaacagacaaag
gctttcgtggaggcacagaacaagatcacagtgccgtttcttgagcagtgtccaatcaga
ggtctatacaaggagaggatgactgagctgtatgactaccccaagtacagctgccacttc
aagaaaggaaagcggtatttttatttttacaatacaggtttgcagaaccagcgagtatta
tatgtacaggactccttagagggggaagccagagtgttcctggatcccaacactctgtcg
gatgacggcacggtggcactccgaggttatgccttcagcgaagatggtgaatacttcgcc
tatggtctgagcgccagcggctcagactgggtgaccatcaagttcatgaaggtcgacggt
gccaaagagcttcccgacgtgctggagagagtcaagttcacctgtatggcctggacgcac
gatggcaaaggaatgttctacaactcatacccacagcaggacggcaagagcgacggcaca
gagacgtccaccaatctccaccagaagctctgttatcacgtcttggggacggatcagtca
gaagacgttctgtgtgccgagttccccgatgagcctaaatggatgggaggagccgagtta
tccgatgacggtcgctatgtcttgttatcgatctgggagggatgtgatccagtgaatcgg
ctgtggtactgtgacctccagcagggatccaatggtatcaacgggatcctgaagtgggta
aaactgatagacaactttgaaggggagtacgattacataaccaacgagggtacggtgttc
accttcaagaccaaccgcaactcccccaattaccggctgatcaacatcgacttcacggac
cccgacgagtccaagtggaaagttctcgttccggagcacgagaaagatgtcttagagtgg
gtggcttgcgtcaggtccaacttcctggtcttgtgctacctccgcaacgtgaagaacatt
ctgcagcttcacgacctgactactggtgctctcctcaagaccttcccgctggacgtgggc
agcgtggtggggtacagtgggcgcaagaaggactctgagatcttctaccagttcacatcc
ttcttatctccaggtgtcatttaccactgtgatcttaccagagaggaactggaaccccgg
gttttccgagaggtgacggtgaagggaatcgatgcgtctgattaccagactatccaggtt
ttctaccctagcaaggatggcacaaagattcccatgtttattgtgcataaaaagggcata
aagttggatggctcgcatcccgctttcctgtatggctacggtggcttcaacatctccatc
acacccaactacagtgtgtccaggctcatttttgtgagacatatgggcggcgtcctcgcg
gtagctaacatcagaggcggtggtgaatacggagaaacgtggcataaaggtgggatcttg
gccaacaagcagaactgctttgatgacttccagtgtgctgctgagtacctcatcaaggaa
ggctacacaacttccaagaggctcacgatcaatggaggctccaatggcggcctcttagtg
gctgcttgcgcaaatcagcgcccggacctcttcggctgtgtgatcgcccaggttggagtg
atggacatgttgaagttccacaaatttactattggccatgcctggaccactgattacggg
tgctccgacagcaaacaacacttcgaatggcttctcaagtactcgccgctgcacaacgtg
aagcttccggaggcggatgacatccagtacccgtccatgctcctcctcacggctgaccac
gacgaccgcgtggtcccgctgcactcgctcaagttcatcgccacgcttcagtacatcgtg
ggccgcagccggaagcagagcaaccccctgctcatccacgtggacaccaaggccggccac
ggggccgggaaacccaccgccaaggtgatagaagaagtctcggatatgtttgcgttcata
gcgcggtgcctgaacatcgagtggatccagtaa

DBGET integrated database retrieval system