KEGG   Rattus norvegicus (rat): 83474
Entry
83474             CDS       T01003                                 

Gene name
Tfam
Definition
(RefSeq) transcription factor A, mitochondrial precursor
  KO
K11830  transcription factor A, mitochondrial
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04371  Apelin signaling pathway
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    83474 (Tfam)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    83474 (Tfam)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    83474 (Tfam)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial transcription factors
    83474 (Tfam)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    83474 (Tfam)
SSDB
Motif
Pfam: HMG_box HMG_box_2 Inhibitor_I34 Protamine_like NAD_binding_9 HMG_box_5 Ccdc124
Other DBs
NCBI-GeneID: 83474
NCBI-ProteinID: NP_112616
RGD: 620682
Ensembl: ENSRNOG00000000613
UniProt: Q91ZW1
Position
20
AA seq 244 aa
MALFRGMWGVLRTLGRTGVEMCAGCGGRIPSPVSLICIPKCFSSLGNYPKKPMSSYLRFS
TEQLPKFKAKHPDAKVSELIRKIAAMWRELPEAEKKVYEADFKAEWKVYKEAVSKYKEQL
TPSQLMGLEKEARQKRLKKKAQIKRRELILLGKPKRPRSAYNIYVSESFQEAKDESAQGK
LKLVNQAWKNLSHDEKQAYIQLAKDDRIRYDNEMKSWEEQMAEVGRSDLIRRSVKRPPGD
ISEN
NT seq 735 nt   +upstreamnt  +downstreamnt
atggcgctgttccggggaatgtggggcgtgctaagaacactggggcgcacgggggtcgag
atgtgcgcgggctgcgggggccgcataccctcgcctgtcagccttatctgtattccgaag
tgtttttccagcttgggtaattatccaaagaaacctatgagttcataccttcgattttct
acagaacagctacccaaatttaaagctaaacacccagatgcaaaagtttcagaactgatt
agaaaaattgcagccatgtggagggagcttccggaagcagaaaaaaaggtgtatgaagcg
gattttaaagctgagtggaaggtgtacaaagaagctgtgagcaagtataaagagcagcta
actccaagtcagctgatgggcttagagaaggaagcccggcagaaacgcctaaagaagaaa
gcacaaatcaagaggagagaattaattttgcttggaaaaccaaaaagacctcggtcagca
tataacatttacgtatctgaaagcttccaggaggctaaggatgagtcagctcaggggaaa
ttgaagcttgtaaatcaggcttggaaaaatctgtctcatgatgaaaagcaggcatatatt
cagcttgctaaagatgatagaattcgttatgacaatgaaatgaagtcttgggaagagcaa
atggctgaagttgggcgaagtgatctcatccgtcgcagtgtgaagcgacccccgggagac
atctctgagaattaa

DBGET integrated database retrieval system