KEGG   Rattus norvegicus (rat): 83476Help
Entry
83476             CDS       T01003                                 

Gene name
Cyr61
Definition
(RefSeq) cysteine-rich, angiogenic inducer, 61
  KO
K06829  cysteine rich protein 61
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    83476 (Cyr61)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cys_knot IGFBP VWC TSP_1
Motif
Other DBs
NCBI-GeneID: 83476
NCBI-ProteinID: NP_112617
RGD: 620763
Ensembl: ENSRNOG00000014350
UniProt: Q9ES72
Position
2q44
AA seq 379 aa AA seqDB search
MSSSTIKTLAVAVTLLHLTRLALSTCPAACHCPLEAPKCAPGVGLVRDGCGCCKVCAKQL
NEDCSKTQPCDHTKGLECNFGASSTALKGICRAQSEGRPCEYNSRIYQNGESFQPNCKHQ
CTCIDGAVGCIPLCPQELSLPNLGCPNPRLVKVSGQCCEEWVCDEDSIKDSLDDQDDLLG
FDASEVELTRNNELIAIGKGSSLKRLPVFGTEPRVLYNPLHAHGQKCIVQTTSWSQCSKS
CGTGISTRVTNDNSECRLVKETRICEVRPCGQPVYSSLKKGKKCSKTKKSPEPVRFTYAG
CSSVKKYRPKYCGSCVDGRCCTPLQTRTVKMRFRCEDGEMFSKNVMMIQSCKCNYNCPHP
NEASFRLYSLFNDIHKFRD
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgagctccagcaccatcaagacgctcgctgtcgccgtcacccttctccacttgaccagg
ctggcactctccacctgccctgccgcctgccactgccctctggaggcgcccaagtgcgcc
ccgggagtcggcttggtccgggacggctgcggctgctgtaaggtctgcgcgaagcaactc
aacgaggactgcagcaaaacgcagccctgcgaccacaccaaggggctggaatgcaatttc
ggcgccagttccaccgctctgaaagggatctgcagagctcagtcagaaggcagaccctgt
gaatataactccaggatctaccagaacggggagagcttccaacccaactgtaaacatcag
tgcacatgtattgacggtgctgtgggctgcattcctctgtgtccccaagaactgtctctc
cccaatctgggctgtcccaacccccggctggtgaaagtcagcgggcagtgctgtgaggaa
tgggtctgtgatgaagacagcattaaggactccctggacgaccaggacgacctccttgga
ttcgatgcctcggaggtggagttaacaagaaacaatgagttaatcgcaattggcaaaggc
agctcactgaagaggcttcctgtctttggcacggaacctcgagtcctttacaaccccctg
catgcccatggccagaaatgcatcgttcagactacgtcctggtcccagtgctccaagagc
tgcggaactggcatctccacacgagttaccaatgacaactcggagtgccgcctggtgaaa
gagacccggatctgtgaagtgcgtccttgtggacaaccagtgtacagcagcctaaaaaag
ggcaagaaatgcagcaagaccaagaaatccccagaaccagtccgatttacttatgcagga
tgctccagtgtgaagaaataccggcccaaatactgcggctcctgcgtggacggccggtgc
tgcacacctctgcagaccaggaccgtgaagatgcggttccggtgcgaagatggcgagatg
ttctccaagaacgtcatgatgattcagtcctgcaagtgtaactacaactgcccgcatccc
aacgaggcgtcgtttcgcctctacagtctgttcaacgatatccacaagttcagggactaa

DBGET integrated database retrieval system