KEGG   Rattus norvegicus (rat): 83477Help
Entry
83477             CDS       T01003                                 

Gene name
Bcl10
Definition
(RefSeq) B-cell CLL/lymphoma 10
  KO
K07368  B-cell CLL/lymphoma 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    83477 (Bcl10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    83477 (Bcl10)
   04660 T cell receptor signaling pathway
    83477 (Bcl10)
   04662 B cell receptor signaling pathway
    83477 (Bcl10)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    83477 (Bcl10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD Flu_B_NS1
Motif
Other DBs
NCBI-GeneID: 83477
NCBI-ProteinID: NP_112618
RGD: 620544
Ensembl: ENSRNOG00000042389
UniProt: Q9QYN5
Position
2q44
AA seq 233 aa AA seqDB search
MEAPAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTS
SRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCS
SCEPFAAGATNNLSRSNSDESNFSEKQRPSTVIYHPEGESSTAPFFSTESSLNLPVLEVG
RLENSSFSSASLPRPGDPGAPPLPPDLRLEEGGSCGNSSEMFLPLRSRALSRQ
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggaggctcccgcgccgtctctcacggaggaggacttaactgaagtgaagaaggacgct
ttagagaatttgcgagtttacctgtgtgagaaaatcatagctgagagacattttgatcat
ctacgagcaaaaaaaattctaagtagagaagacacagaagaaatttcttgccgaacttca
agtagaaaaagggctgggaagttgttagactacttacaggaaaaccccaagggactggac
acccttgtggaatccattcgcagggagaaaacacagaacttcctgattcagaagataacg
gatgaggtgctaaagcttcggaatataaaactggagcacctcaaaggcctgaagtgcagt
agctgtgagcccttcgcagctggagccaccaacaacctttctaggtccaattctgatgag
agcaacttctccgagaaacagagaccatccacggtcatctaccatccagagggagagtcg
agcactgctcccttcttctctaccgagtcatccctgaatctgccggtcctggaagttggc
aggctggaaaacagcagcttctcttcagcctcgcttcctcggcctggggaccctggggcc
ccccctttgcccccagacctgcggttagaagagggggggagttgtggaaactcaagtgag
atgtttctccccttacggtcacgggctctttcacggcagtga

DBGET integrated database retrieval system