KEGG   Rattus norvegicus (rat): 83497Help
Entry
83497             CDS       T01003                                 

Gene name
Ocln
Definition
(RefSeq) occludin
  KO
K06088  occludin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules (CAMs)
rno04530  Tight junction
rno04670  Leukocyte transendothelial migration
rno05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    83497 (Ocln)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    83497 (Ocln)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    83497 (Ocln)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    83497 (Ocln)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    83497 (Ocln)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    83497 (Ocln)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     83497 (Ocln)
Transporters [BR:rno02000]
 Other Transporters
  Others
   83497 (Ocln)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MARVEL Occludin_ELL APG6_N FoP_duplication CitMHS TadF
Motif
Other DBs
NCBI-GeneID: 83497
NCBI-ProteinID: NP_112619
RGD: 620089
Ensembl: ENSRNOG00000018297
UniProt: Q6P6T5
Position
2q12
AA seq 523 aa AA seqDB search
MSVRPFESPPPYRPDEFKPNHYAPSNDMYGGEMHVRPMLSQPAYSFYPEDEILHFYKWTS
PPGVIRILSMLVIVMCIAVFACVASTLAWDRAYGTGIFGGSMNYPYGSGFGSYGGGFGGY
GYGYGYGYGGYTDPRAAKGFLLAMAAFCFIASLVIFVTSVIRSGMSRTRRYYLIVIIVSA
ILGIMVFIATIVYIMGVNPTAQASGSMYGSQIYTICSQFYTPGGTGLYVDQYLYHYCVVD
PQEAIAIVLGFMIIVAFALIIVFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKN
VSAGTQDMPPPPSDYAERVDSPMAYSSNGKVNGKRSYPDSLYKSPPLVPEVAQEIPLTLS
VDDFRQPRYSSNDNLETPSKRTPTKGKAGKAKRTDPDHYETDYTTGGESCDELEEDWLRE
YPPITSDQQRQLYKRNFDAGLQEYKSLLAELDEVNKELSRLDRELDDYREESEEYMAAAD
EYNRLKQVKGSADYKSKKNYCKQLKSKLSHIKRMVGDYDRRKT
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgaggccttttgagagtccacctccttacaggccggatgaattcaaacccaat
cattatgcaccaagcaatgacatgtatggcggagagatgcacgttcgaccaatgctctct
cagccggcatactctttttacccggaagacgaaattcttcacttctacaagtggacgtcg
cctccaggggtgattcggatcctgtctatgctcgtcatcgtgatgtgcatcgctgtattc
gcctgcgtggcttccacacttgcttgggacagagcctatggaacgggcatctttggagga
agtatgaactacccttacggcagcggcttcggtagctatggaggtggcttcggaggttac
ggttacggctacggttacggctatggagggtacacagaccccagagcggcaaagggtttc
ctgctggccatggcggccttttgcttcatcgcttccttggtgatctttgttaccagcgtc
attagatcgggaatgtccagaacgagaagatactacttgatcgtgatcatagtcagcgca
atcctgggcatcatggtgttcattgccacgatcgtgtacataatgggagtcaacccgact
gcccaggcttctggatctatgtacggttcacagatctataccatctgcagccagttttat
actcctggaggcactggtctctacgtggaccaatatttgtatcactactgtgtggtggat
ccccaggaggctatagccattgtcctggggttcatgattattgtggcttttgctttaatc
attgtttttgctgtgaaaacccgaagaaagatggaccggtatgataagtctaatattttg
tgggataaggaacacatttatgatgaacagccccctaatgtggaagagtgggttaaaaat
gtgtctgcaggcacacaagacatgcctccacccccatctgactatgcggaaagagtcgac
agtccaatggcctactcctccaacggcaaagtgaatggcaagagatcctacccagactct
ttgtataagtcaccgcctctggtacctgaagtagcccaggagattcctctgaccttgtcc
gtggatgacttcaggcagcctcggtacagcagcaacgataacctagagacaccttctaaa
aggactcccacgaaggggaaagcagggaaggcgaagaggacagacccagaccactatgaa
accgactacacgacaggtggcgagtcctgcgatgagctggaggaggactggctcagggaa
tatccacctatcacttcagatcaacagagacaactgtacaagagaaattttgatgcaggt
ttacaggagtataagagtttactggcagaactcgacgaggtcaacaaagagctctctcgt
ctcgacagagaactggatgactacagagaggagagcgaagagtacatggctgctgctgat
gaatataacagactaaagcaagttaagggatctgcagattataaaagcaagaagaattac
tgcaagcagttaaagagcaaattatcacacatcaagaggatggtgggagactatgacaga
cggaaaacctag

DBGET integrated database retrieval system