KEGG   Rattus norvegicus (rat): 83498Help
Entry
83498             CDS       T01003                                 

Gene name
Hnrnpab, A1F-C1, Hnrpab
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein A/B
  KO
K13044  heterogeneous nuclear ribonucleoprotein A/B/D
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    83498 (Hnrnpab)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   HnRNP proteins
    83498 (Hnrnpab)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 CBFNT RRM_7 Nup35_RRM_2 RRM_3 NID DUF2462 Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 83498
NCBI-ProteinID: NP_112620
RGD: 69255
Ensembl: ENSRNOG00000003645
UniProt: Q9QX80
Position
10q21
AA seq 285 aa AA seqDB search
MSDAAEEQPMETTGATENGHEAAPEGEAPVEPSPGAAAPATPAGSGGGTTAAPSGNQNGA
EGDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGF
ILFKDSSSVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFG
QFGEIEAIELPIDPKLNKRRGFVFITFKEEDPVKKVLEKKFHTVSGSKCEIKVAQPKEVY
QQQQYGSGGRGNRNRGNRGSGGGQGSTNYGKSQRRGGHQNNYKPY
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgcggctgaggagcagcccatggagacgacgggcgccaccgagaacggacac
gaggccgcccccgaaggcgaggccccggtcgagcctagccctggggcagcggcccccgcg
actccggcggggtctgggggcgggaccacggccgccccgagcgggaaccagaacggcgcc
gaaggcgaccagatcaacgccagcaagaacgaggaggacgcgggaaaaatgttcgttggt
ggtctgagctgggataccagcaaaaaagatctaaaggattattttactaagtttggagag
gtcgttgactgtacaataaaaatggatccgaacactggtcgatcaagagggtttgggttt
attctcttcaaagattcttctagtgtggagaaggtcttagatcagaaggagcacagactg
gatggtcgtgtcattgaccctaaaaaggctatggctatgaagaaggaccctgtgaagaaa
atctttgtgggaggtctaaaccctgaagccacagaggaaaagatcagagaatactttggc
cagtttggggagattgaggccattgaacttccaatagatcccaagttgaacaaaagacgg
ggttttgtttttattacatttaaagaggaagaccctgtgaagaaagttctggagaaaaaa
ttccatactgtcagtggtagcaagtgtgaaatcaaggttgcccagcccaaagaggtgtac
cagcaacagcagtatggctctgggggccgaggaaatcgcaatcgagggaaccgaggcagt
ggtggaggtcagggtagtacaaattacgggaagagccagcgacgtggtggtcatcagaat
aactacaagccatactga

DBGET integrated database retrieval system