KEGG   Rattus norvegicus (rat): 83502Help
Entry
83502             CDS       T01003                                 

Gene name
Cdh1
Definition
(RefSeq) cadherin 1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04371  Apelin signaling pathway
rno04390  Hippo signaling pathway
rno04514  Cell adhesion molecules (CAMs)
rno04520  Adherens junction
rno05100  Bacterial invasion of epithelial cells
rno05200  Pathways in cancer
rno05213  Endometrial cancer
rno05216  Thyroid cancer
rno05218  Melanoma
rno05219  Bladder cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    83502 (Cdh1)
   04390 Hippo signaling pathway
    83502 (Cdh1)
   04371 Apelin signaling pathway
    83502 (Cdh1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    83502 (Cdh1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    83502 (Cdh1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    83502 (Cdh1)
  09162 Cancers: Specific types
   05226 Gastric cancer
    83502 (Cdh1)
   05216 Thyroid cancer
    83502 (Cdh1)
   05218 Melanoma
    83502 (Cdh1)
   05219 Bladder cancer
    83502 (Cdh1)
   05213 Endometrial cancer
    83502 (Cdh1)
  09171 Infectious diseases: Bacterial
   05100 Bacterial invasion of epithelial cells
    83502 (Cdh1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    83502 (Cdh1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    83502 (Cdh1)
   04090 CD molecules [BR:rno04090]
    83502 (Cdh1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    83502 (Cdh1)
Cell adhesion molecules [BR:rno04515]
 Cadherins
  Major cadherins
   83502 (Cdh1)
CD molecules [BR:rno04090]
 Proteins
  83502 (Cdh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro Big_9
Motif
Other DBs
NCBI-GeneID: 83502
NCBI-ProteinID: NP_112624
RGD: 69279
Ensembl: ENSRNOG00000020151
UniProt: Q9R0T4
Position
19q12
AA seq 886 aa AA seqDB search
MGARCRSFSALLLLLQVSSWLCQQPESESDSCRPGFSSEVYTFLVPERHLERGHILGRVK
FEGCTGRPRTAFFSEDSRFKVSTDGVITVKRHLKLHKLETSFLVHAWDSSYRKLSTKVTL
KSLGHHHHRHHHRDPVSESNPELLTFPSFHQGLRRQKRDWVIPPINCPENQKGEFPQRLV
QIKSNRDKETTVFYSITGPGADKPPVGVFIIERETGWLKVTQPLDREAIDKYLLYSHAVS
SNGEAVEDPMEIVVTVTDQNDNRPEFIQEVFEGSVAEGALPGTSVMQVSATDADDDINTY
NAAIAYTILSQDPELPHKNMFTVNRDTGVISVVTSGLDRESYPTYTLVVQAADLQGEGLS
TTAKAVITVKDINDNAPIFNPSTYQGQVLENEVGARIATLKVTDDDAPNTPAWNAVYTVV
NDPDHQFTVITDPKTNEGILKTAKGLDFEAKQQYILHVTVENEEPFEGSLVPSTATVTVD
VVDVNEAPIFVPAEKRVEVPEDFGVGLEIASYTAREPDTFMEQKITYRIWRDTANWLEIN
PETGVISTRAEMDREDSEHVKNSTYTALIIATDDGSPIATGTGTLLLVLSDVNDNAPIPE
PRNMQFCQRNPKPHVITILDPDLPPNTSPFTAELTHGASVNWTIEYNDAEQESLILQPRK
DLEIGEYKINLKLSDNQNKDQVTTLEVHVCDCEGTVNNCMKAISLEAGLQVPAILGILGG
ILALLILILLLLLFLRRRTVVKEPLLPPDDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGL
DARPEVIRNDVAPTLMSMPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYE
GSGSEAASLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGGGEED
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atgggagcccggtgccgcagcttctccgcgctcctgctcctgctgcaggtctcctcgtgg
ctttgtcagcagccggagtcggagtctgactcctgccgtcccggcttcagttccgaggtc
tacaccttcctggtgccggagaggcacctggagagaggccacatcctgggcagagtgaaa
tttgaaggatgcaccggccgtccaaggacagccttcttttctgaagactcccgattcaaa
gtgtctacagatggcgtcatcacagtcaaacggcatctaaagcttcacaagctggagacc
agttttctcgtccatgcctgggactccagttacaggaagctttctaccaaagtgacactg
aagtccctgggccaccaccaccaccggcatcaccacagagaccctgtctctgaatccaac
ccagagctgctcacgtttcccagctttcaccagggtctgagaagacagaaacgagactgg
gtcatccctcccatcaactgcccggaaaatcaaaagggcgaattcccccagcgactggtt
cagatcaaatccaacagggacaaagagacaacggttttctacagcatcaccggcccagga
gctgacaaaccccctgttggcgttttcatcattgagagggagacaggctggctgaaagtg
acgcagcctctggacagagaagccattgacaagtaccttctctactctcatgctgtgtca
tcaaatggggaagccgtggaggatcccatggagatagtggtcacagtcacagatcagaat
gacaacaggccagagtttatccaggaggtctttgagggatctgttgcagaaggcgctctt
ccaggaacctccgtgatgcaggtctcagccactgatgcagacgatgacataaacacctac
aatgctgccatcgcctacaccatcctcagccaagatcctgagctgcctcacaaaaacatg
ttcactgtcaaccgggacactggggtcatcagtgtggtcacctccggactggaccgagag
agttaccctacatatactctggtggttcaggctgccgaccttcaaggcgaaggcctaagc
acaacagcaaaagctgtgatcactgtcaaggatattaatgacaacgctcccatcttcaac
ccaagcacgtaccagggtcaagtgcttgagaatgaggtcggtgcccgtattgccacactc
aaggtgactgatgatgatgcccccaacactccagcgtggaatgctgtgtacaccgtagtc
aatgatcctgatcatcagttcactgtcatcacagaccccaagaccaacgagggcattctg
aaaacagccaagggcttggattttgaggccaagcagcagtacattctgcacgtgacagtg
gaaaatgaggagccctttgaggggtctcttgtcccttccacagccactgtcaccgtggat
gtggtagacgtgaatgaagcccccatttttgtgcctgcggagaagagagtcgaggtgcct
gaggactttggtgtgggtctggagatcgcatcttacactgcgcgagagccagacacattc
atggaacagaagatcacgtatcggatttggagggacactgccaattggctggagattaac
ccagagactggggtcatttccactcgggctgagatggacagagaagattcggagcatgtg
aagaacagcacgtatacagctctcatcattgccacagatgatggttcacccattgccact
ggcacagggactcttctcctggtcctgtcagacgtcaacgacaatgctcccatcccagaa
cctcgaaatatgcagttctgccagagaaacccgaagccccatgtcatcaccatcttggat
ccagaccttcccccaaacacatcccccttcactgcagagctcacccatggggccagcgtc
aactggaccattgagtacaatgacgcagaacaagaatctctcattttgcaaccaagaaag
gacttagagattggcgaatacaaaatcaatctcaagctctcggataaccagaataaagac
caggtgaccacgttggaggtccacgtgtgtgactgtgaagggaccgtcaacaactgcatg
aaggcgatctccctggaagcaggattacaagttcccgccatccttggaatcctgggaggg
atcctggccctcctgattctgatcctcctgctcctactgtttctacggaggagaacggtg
gtcaaagagcccttgctgccaccagatgacgatacccgggacaatgtgtattactatgat
gaagagggaggtggagaagaagaccaggactttgatttgagccagctgcacaggggcctt
gatgccagaccggaagtgattcgaaatgatgtggctcccaccctcatgagcatgccccag
tatcgtccccgtccagccaatcctgatgaaatcgggaacttcatcgatgaaaacctgaag
gcagcggacagtgaccccacagcgcccccttacgactctctgttggtgtttgactatgag
gggagtggttctgaagctgcctccctgagctcgctgaactcctctgagtcagatcaggac
caggactacgattatctgaacgaatggggcaaccggttcaagaagctggccgatatgtat
ggtggcggcgaagaagactag

DBGET integrated database retrieval system