KEGG   Rattus norvegicus (rat): 83504Help
Entry
83504             CDS       T01003                                 

Gene name
Kl
Definition
(RefSeq) Klotho
  KO
K14756  klotho [EC:3.2.1.31]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno01100  Metabolic pathways
rno04211  Longevity regulating pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04961  Endocrine and other factor-regulated calcium reabsorption
Module
rno_M00014  Glucuronate pathway (uronate pathway)
rno_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    83504 (Kl)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    83504 (Kl)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    83504 (Kl)
  09149 Aging
   04211 Longevity regulating pathway
    83504 (Kl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    83504 (Kl)
   04147 Exosome [BR:rno04147]
    83504 (Kl)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.31  beta-glucuronidase
     83504 (Kl)
Transporters [BR:rno02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   83504 (Kl)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   83504 (Kl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 83504
NCBI-ProteinID: NP_112626
RGD: 620396
Ensembl: ENSRNOG00000001092
UniProt: Q9Z2Y9
Position
12p12
AA seq 1014 aa AA seqDB search
MPARAPPRRLPRLLLLRLLSLHLLLLTLRARCLSAEPGQGAQTWARFARPPVPEASGLLH
DTFPDGFLWAVGSAAYQTEGGWRQHGKGASIWDTFTHHPRAIPEDSPIVMAPSGAPLPPL
PSTGDVASDSYNNVYRDTEGLRELGVTHYRFSISWARVLPNGTAGTPNREGLRYYRRLLE
RLRELGVQPVVTLYHWDLPQRLQDTYGGWANRALADHFRDYAELCFRHFGGQVKYWITID
NPYVVAWHGYATGRLAPGVRGSSRLGYLVAHNLLLAHAKVWRLYNTSFRPTQGGRVSIAL
GSHWITPRRMTDYHIRECQKSLDFVLGWFAKPIFIDGDYPKSMKNNLSSLLPDFTESEKR
FIRGTADFFALSFGPTLSFQLLDPSMKFRQLESPSLRQLLSWIDLEYNHPQIFIVENGWF
VSGTTRRDDAKYMYYLKKFIMESLKAIRLDGVDVIGYTAWSLMDGFEWHRGYSIRRGLFY
VDFLSQDKELLPKSSALFYQKLIENNGFPPLPENQPLEGTFPCDFAWGVVDNYIQVDPTL
SQFTDPNVYLWDVHHSKRLIKVDGVVAKKRKPYCVDFSAIRPQITLLREMRVTHFRFSLD
WALILPLGNQTQVNRTVLHFYRCMVSELVHANITPVVALWQPATPHQGLPHALAKHGAWE
NPHTALAFADYANLCFEELGHWVKFWITINEPNSRNMTYRAGHHLLKAHALAWHLYDDKF
RAAQKGKISIALQVDWIEPACPFSQKDKEVAERVLEFDVGWLAEPIFGSGDYPHVMREWL
NQKNNFLLPYFTEDEKKLIRGSFDFLALSHYTTILVDWEKEDPIKYNDYLEVQEMTDITW
LNSPNQVAVVPWGLRKALNWLRFKYGDLPMFVTANGIDDDPHAEQDSLRMYYIKNYVNEA
LKAYVLDGINLCGYFAYSLSDRSVPKSGFYRYAANQFEPKPSIKHYRKIIDNNGFLGSGT
LGRFCPEEYTVCTGCGFFQTRKSLLAFISFLVFAFVTSLALIYYYSKKGRRRYK
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
atgccagcccgcgcccctcctcgccgcctgccgcggctcttgctgctccgtttgctgtcg
ctgcatctgctgttgctcaccctgcgcgcccgctgcctaagcgctgagccgggtcagggc
gcgcagacctgggctcgctttgcgcgccctcctgtcccagaggcctctggcctcctccat
gacaccttccccgatggtttcctctgggcggtaggcagcgccgcctaccagacggagggc
ggctggcgacagcacggcaaaggcgcgtccatctgggacactttcacccatcaccctcgg
gccatcccggaggactccccgatcgtcatggcgccgtcgggtgccccgttgcctcccctg
ccctccactggagatgtggccagcgacagttacaacaacgtctaccgcgacacagagggg
ctacgcgaactgggggtcacccactaccgcttctccatatcgtgggcgcgggtgctcccc
aatggcaccgcgggcacccccaaccgcgaggggctgcgctactaccggcggctgctggag
cggctgagggagctgggcgtgcagccggtggtcactctgtaccattgggacctgccgcag
cgcctgcaggacacctatggcggctgggccaatcgcgccctggccgaccatttcagggat
tacgccgagctctgcttccgccacttcggtggtcaggtcaagtactggatcaccattgac
aacccctacgtggtggcctggcacgggtacgccaccggccgcctggccccgggcgtgcgg
ggcagctccaggctcgggtacctggttgcccacaacctacttttggctcacgccaaagtc
tggcgtctctacaacacctccttccgccccactcaggggggccgggtgtccatcgcctta
ggttcccattggatcacccctcgaaggatgaccgactatcacatcagagagtgtcagaag
tctcttgacttcgtgctaggctggtttgccaagcccatatttatcgatggcgactaccca
aagagtatgaagaacaacctctcatccctgctgcccgattttactgaatccgagaagaga
ttcatcaggggaacagctgacttctttgctctctccttcggaccaaccttgagctttcaa
ctactggaccccagcatgaagttccgccagctggagtctcccagcctgaggcagcttctg
tcttggatagatctggagtataaccaccctcagatatttattgtagaaaatggctggttt
gtctcggggaccaccagaagagatgatgccaaatacatgtattatctcaagaagttcata
atggaaagcttaaaagccatcaggctggatggggtcgacgtcattgggtacaccgcatgg
tccctcatggatggtttcgagtggcacaggggctacagcatccgacgaggactcttctat
gtcgactttctgagtcaggacaaggagttgttgcccaagtcttcggccttgttctaccaa
aagctgatagagaacaatggcttccctcctttacctgagaaccagccccttgaagggacg
tttccctgtgactttgcttggggagtggttgacaactacattcaagtggaccccactctc
tctcagtttactgacccgaatgtctatctgtgggatgtgcatcacagtaagaggcttatt
aaagtagacggggttgtagccaagaagagaaaaccttactgtgttgatttctctgccatc
cggcctcagataaccttacttcgagaaatgcgggtcacccactttcggttctccctagac
tgggccctgatcttgcctctgggtaaccagactcaagtgaaccgcacggttctgcacttc
taccgctgtatggtcagcgagctggtgcacgccaacatcactccagtggtggccctgtgg
caaccagcaaccccacaccaaggcctgccacatgcccttgcaaaacatggggcctgggag
aacccgcacactgccctggcatttgcagactacgcaaacctgtgctttgaagagctaggc
cactgggtcaagttctggatcaccataaatgagccaaactcacggaacatgacataccgt
gcggggcaccacctgcttaaggctcatgccttggcatggcacctgtacgatgacaaattt
agggcggctcagaaaggcaaaatatccatcgccttgcaggttgactggatagaaccggcc
tgcccattctctcagaaggacaaagaagtggcggagagagttttggaatttgatgtaggc
tggctggcagagcccattttcggctccggagattatccgcatgtgatgagggaatggctg
aaccaaaaaaacaactttcttctgccctatttcacggaagatgagaaaaagctaatccgg
ggttcctttgacttcctggcgttgagccattacaccaccatccttgtagactgggaaaag
gaggatccgataaaatacaacgattacctggaggtgcaggagatgactgacatcacgtgg
ctcaactcccccaatcaggtggcggtggtgccttgggggctgcgcaaagcgctcaactgg
ctaaggttcaagtatggagacctcccgatgttcgtgacagccaatggcattgatgacgat
ccccatgccgagcaagactcactgaggatgtattatattaagaattacgtgaatgaggct
ctgaaagcctacgtgttggacggcatcaacctttgtggctactttgcgtattcgcttagt
gaccgctcagttcccaagtccggcttttatcgatacgctgcgaatcagttcgagcccaaa
ccgtctattaaacattacaggaaaattattgacaacaacggcttcctgggttctggaacg
ctgggaaggttttgtccggaagagtacaccgtgtgcaccggatgcggcttttttcaaacc
cggaagtccctgctggccttcatctcgtttctagtttttgctttcgttacttctctcgct
cttatttattactactccaagaaaggccggagacgttataaataa

DBGET integrated database retrieval system