KEGG   Rattus norvegicus (rat): 83506Help
Entry
83506             CDS       T01003                                 

Gene name
Camkk2
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase kinase 2
  KO
K07359  calcium/calmodulin-dependent protein kinase kinase 2 [EC:2.7.11.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04920  Adipocytokine signaling pathway
rno04921  Oxytocin signaling pathway
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    83506 (Camkk2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    83506 (Camkk2)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    83506 (Camkk2)
   04921 Oxytocin signaling pathway
    83506 (Camkk2)
  09149 Aging
   04211 Longevity regulating pathway
    83506 (Camkk2)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    83506 (Camkk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    83506 (Camkk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     83506 (Camkk2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  CAMKK family
   83506 (Camkk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 83506
NCBI-ProteinID: NP_112628
RGD: 620092
Ensembl: ENSRNOG00000001309
UniProt: O88831
Position
12q16
AA seq 587 aa AA seqDB search
MSSCVSSQPTSDRAAPQDELGSGGVSRESQKPCEALRGLSSLSIHLGMESFIVVTECEPG
RGVDLSLARDQPLEADGQELPLDASEPESRSLLSGGKMSLQERSQGGPASSSSLDMNGRC
ICPSLSYSPASSPQSSPRMPRRPTVESHHVSITGLQDCVQLNQYTLKDEIGKGSYGVVKL
AYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAILK
KLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIE
YLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLSE
TRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKD
LITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIPSL
ATVILVKTMIRKRSFGNPFEGSRREERSLSAPGNLLTKKPTREWEPLSEPKEARQRRQPP
GPRASPCGGGGSALVKGGPCVESCGAPAPGSPPRTPPQQPEEAMEPE
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatgtgtctctagccagcccaccagcgaccgggcggccccccaggatgagctg
ggaagcgggggtgtcagccgggaaagccagaagccctgcgaggcactgcggggactctca
tccttaagcatccacttgggcatggaatccttcatcgtggtcaccgagtgtgaaccaggc
cggggcgtggacctcagcctggccagagaccaacctctggaggccgatggccaggaactc
cctctggatgcctcggaacctgagtcacggtccctgctttctggtggcaagatgtccctc
caggagcggtcccagggcgggccggcgtccagcagcagcctggacatgaatggacgctgc
atctgcccatccctgtcctactcaccagccagctccccacagtcctctccccggatgccc
cggcggcccacagtggagtcgcaccacgtctccatcacgggtttgcaggactgtgtgcag
ctgaatcagtacacgctgaaggatgaaattggaaagggctcctatggcgttgtcaagctg
gcctacaatgaaaatgacaatacttattatgcaatgaaagtgctgtccaaaaagaagctg
atccgacaggccggctttccacgtcgccccccacctcgaggtactcgcccagctccaggg
ggctgcatccagcccaggggccccatcgagcaggtgtatcaggaaattgccatcctcaag
aagctggatcaccccaacgtggtgaagctggtggaggtcctggatgaccctaacgaggac
catctgtacatggtgtttgaactggtcaaccaagggcctgtgatggaagttcccaccctc
aagccactgtctgaagaccaggcccggttctacttccaagatctgatcaaaggcattgag
tacttacactaccagaagatcattcaccgggacatcaaaccctccaacctcctagtgggg
gaggacgggcacatcaagatagccgacttcggcgtgagcaatgagttcaagggcagcgac
gccttgctgtctaacaccgtgggcacgcctgccttcatggcgcccgagtcgctctcagag
acccggaagatcttctccggaaaggccttggatgtttgggccatgggtgtgacactatac
tgctttgtttttggccagtgccctttcatggatgaacgaatcatgtgtttgcacagtaag
atcaagagtcaggccctggagtttccagaccagcctgacatagccgaagacttgaaagat
ctgatcacccggatgttggacaagaacccagagtccaggattgtggtgcctgaaatcaag
ctgcacccttgggtcacgaggcacggggccgagccactgccgtcggaggacgagaactgc
acactggtcgaggtgaccgaagaggaggtcgagaattcagtcaaacacattcccagcctg
gcaactgtgatcctagtgaagaccatgattcggaaacggtcttttgggaacccatttgaa
ggtagccggcgggaggagcgttccttgtcagcacccggaaacctgctcaccaaaaaacca
accagggagtgggagcccttgtctgagcccaaggaagcaaggcagcgaagacagcctccg
gggcccagagccagcccctgtgggggaggaggaagtgctcttgtgaaaggtggtccctgc
gtggaaagttgcggggctccggcccctggctccccgccacgcacgcctccacagcagccc
gaggaggccatggagccggagtag

DBGET integrated database retrieval system