KEGG   Rattus norvegicus (rat): 83508
Entry
83508             CDS       T01003                                 

Gene name
Timeless, Tim
Definition
(RefSeq) timeless circadian clock
  KO
K03155  timeless
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    83508 (Timeless)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Check point factors
   FPC (fork protection complex)
    83508 (Timeless)
SSDB
Motif
Pfam: TIMELESS TIMELESS_C Myc_N NAT_N
Other DBs
NCBI-GeneID: 83508
NCBI-ProteinID: NP_112630
RGD: 620939
Ensembl: ENSRNOG00000031916
UniProt: Q9Z2Y1
Position
7q11
AA seq 1205 aa
MDLYMMNCELLATCSALGYLEGGTYHKEPDCLESVKDLIRYLRHEDETRDVRQQLGAAQI
LQSDLLPILTQHRQDKPLFDAVIRLMVNLTQPALLCFGSVPKDPTVRHHFLQVLTYLQAY
KEAFASEKAFGVLSETLYELLQLGWEDRQEEDNLLIERILLLVRNILHVPANLEQEKRID
DDASIHDRLLWAIHLSGMDDLLLFLSSSSAEQQWSLHVLEIISLMFRDQKPEQLAGVGQG
RLAQERSTDLAELEVLRQREVAEKRARALQRGNRHSRFGGSYVVQGLKSIGERDVVFHKG
LHNLQNYSSDLGKQPRRVPKRRQAAQELSVHRRSVLNVRLFLRDFCSEFLENCYNPLMGA
VKDHLLREKAQQHDETYYMWAMAFFMAFNRAAAFRPGFVSETLSIRTFHFVEQNLTNYYE
MMLTDRKEAASWARRMHLALKAYQELLATVNEMDMCPDDAVRESSRIIKNNIFYMMEYRE
LFLALFRKFDERYHPRSFLCDLVETTHLFLKMLERFCRSRGNLMVQNKRKKRKKKKKAQE
QGVAFSRSPEELQAMWSALAERLLQCAQEPELSVDSIIPFDAASEVPVEEQRVEAMVRIQ
DCLVAGQAPQALALLRSAREVWPEGNVFGSPVISPGEEMQLLKQILSATLPRQQEPVEGD
AEEEDEEEEEEEEEELQVVQVSEKEFKFLDYLKRFACSTIVRAYVLLLRSYRQNSAHTNH
CIAKMLHRLAHDLGMEALLFQLSLFCLFNQLLSDPAAAAYKELVTFAKYILGKFFALAAV
NQKAFVELLFWKNTSVVREMTQGYGSLDSGSCSHRAPVWSSEEEAQLQELYLAHKDVEGQ
DVVETILAHLKAVPRTRKQVIHHLVRMGLADSVKDFQRKGTQIVLWTEDQELELQRLFEE
FQDSDDVLGHIMKNITAKRSRARVVDKLLALGLVSERRQLHKKRRKKLAPSCMQNGEESQ
RDAWQEDPEEEEEKEGLPESEGEENEEDLLAGQVQGSSSLSAENLRQSLCQDGLSAPLLW
LQSSLIRAADDREEDGCSQAIPLVPLTEENEEAMENKQFQHLLRKLGIRAPCSGQETFWR
IPAKLSSTQLRRVAASLSERENKEEREEEPEPNPGVPGEQSPSEEHQVRAPRALLSARKR
KAGLVFPKEEATGEEEWKSVPKKQQLLDSDEEDTDDERGGQAAVSGTLRIHKEKRFLVED
EDEDY
NT seq 3618 nt   +upstreamnt  +downstreamnt
atggacttgtacatgatgaactgtgaacttctagccacttgtagcgcccttgggtacttg
gaaggaggcacttaccacaaggagccggactgcttggagagtgtgaaggatttgatccga
tacctgaggcatgaggacgagactcgagatgtgcggcagcagctgggagccgcgcagatc
ctgcagagtgatctcctgccaatcctcacccagcaccgccaggacaagcctctctttgat
gctgtgatcaggctgatggtaaatttgactcagccagccttgctctgttttggcagcgtg
cctaaggaccccactgtacgacaccattttctgcaggttctaacctacctgcaggcctac
aaagaggcctttgccagtgaaaaggcatttggagtcctcagcgaaaccttgtatgagcta
ctgcagctgggctgggaggatcggcaagaagaagacaacttgctgattgaacggatcctt
ctgttggtcagaaatattctccatgtcccagccaaccttgagcaggagaagaggatcgat
gacgatgccagcattcatgaccggcttctgtgggcaattcacctcagtggcatggacgac
ttgctcctcttcctgtccagctcatccgctgagcagcagtggagcctccatgtgctggag
atcatctccctcatgttccgagaccagaagcctgagcagctggcaggagtagggcaggga
cgcttggctcaggagcgaagcacagatttggcagaattggaagtgctgcgccaacgggag
gtggccgagaagagagcccgagccctgcagcgaggaaacaggcactctcgatttgggggc
tcctatgttgtccaggggttgaaatctattggggagagggatgtcgtctttcacaaaggc
cttcacaacctccagaactacagctcagatctaggaaagcagccccggagggtgcctaag
cgtcgtcaggctgcccaggagctgtctgtccatcgccgctctgtcctgaatgtgaggctc
ttcctcagagacttctgctctgagttcctggagaactgttacaacccactcatgggtgca
gtcaaggatcacctgcttcgggagaaagctcagcaacatgatgagacgtactacatgtgg
gcgatggctttctttatggccttcaaccgagctgctgccttccgccctggctttgtctct
gagaccctcagtatccggacctttcactttgtggagcagaacctcaccaactactatgag
atgatgctgacagaccgcaaggaggccgcctcctgggcacgcaggatgcacctggctctg
aaggcctatcaggagctgctggccacagtgaatgagatggacatgtgcccagacgacgct
gtcagggagagcagtcgcatcatcaaaaacaacattttctacatgatggagtaccgagaa
ctatttctggcactctttcgaaaattcgatgagagataccatccacgttcattcctttgt
gacctggtggagaccactcacctcttcctcaaaatgttggagcgcttctgtcggagccga
gggaacctgatggtgcagaacaaaagaaagaagagaaaaaagaaaaagaaggcccaggag
cagggtgttgctttctcacgtagccctgaggagctgcaggccatgtggtcagcgctggca
gagcggctgctgcagtgcgcccaggaacctgagctcagtgtggactccatcattcccttt
gatgcggcctcagaggtgccagtggaggagcagcgggtagaagctatggtgaggatccaa
gactgccttgtggctggccaggccccgcaagccttggccctcctgcggtctgcccgggaa
gtgtggcctgaaggaaatgtgtttggctctccagtcatttccccaggggaagaaatgcag
ttgctaaaacaaatcctctctgcaacccttccccggcagcaagagccagtagaaggagat
gcagaggaggaagatgaagaggaggaggaggaggaagaggaggagttacaggtggtccag
gtgtcagagaaggagtttaagtttttggactacttgaaacgctttgcatgctcaaccatt
gtgcgagcctatgtgcttctcctgcggagctaccggcagaacagcgctcacaccaaccac
tgcatcgccaagatgctgcaccggctggcccatgacctggggatggaagccctgcttttc
cagctctccctgttctgcctcttcaaccagctactcagtgacccagccgctgcagcctac
aaagagctagtgacttttgccaaatacatcctcggcaagttctttgcgttggctgcagtg
aaccagaaagcatttgtggagctgctgttctggaagaacacctcggtggttcgggaaatg
acccagggatatggctcccttgacagtgggtcttgcagccacagagcccctgtgtggagc
tctgaggaagaggcccagcttcaagaactatacctcgcccacaaggatgtagaaggtcag
gatgtagtggagaccatcttggcacacctgaaagctgtccctcggacacgcaagcaggtc
atccaccatctggtacgcatgggcctggccgacagtgtcaaggacttccagaggaaaggg
acccagattgtcttgtggacagaggatcaggagctggagttacagcggctctttgaggag
ttccaggattccgatgatgttcttggtcatatcatgaagaatatcacagccaaacgttca
cgggctcgagtagtggacaaactgttggccctgggactcgtgtccgagcgcaggcaactg
cacaagaaacggaggaagaagctggcgccctcttgcatgcagaatggggaagagtcccag
agagatgcttggcaggaagatccagaagaagaagaggaaaaagaaggcttgccagagagt
gagggtgaggagaacgaggaagacttgttagcaggacaggtccagggcagctcatctctt
tctgctgaaaacctccgtcagagcctttgtcaggacggcctctctgctcccctcctgtgg
ctccagagctccctgattcgcgcagcagatgaccgagaagaggatggctgctcccaggcc
atccctctggtgcctctgacggaagaaaatgaggaagcaatggagaacaaacagtttcag
catctgctacgtaagctaggaatccgggccccctgctcaggacaggaaaccttctggcga
attccagccaaactgagctccacccagcttcggagagtggctgcttctctgagtgagcga
gaaaacaaggaggaaagagaggaggagccagagccgaatccaggagtccctggagagcag
agtcccagtgaggagcaccaagtgagagccccgagagcccttttgtcagctcgtaaaagg
aaagcaggcctggtgtttccaaaagaggaggccactggggaggaagaatggaaatcggtg
cctaagaagcagcaactgctggacagcgacgaagaggacaccgacgacgagaggggaggg
caagcagcagtgtcgggaaccctgagaatccacaaggagaaacggtttctggttgaggat
gaagatgaggattactga

DBGET integrated database retrieval system