KEGG   Rattus norvegicus (rat): 83511Help
Entry
83511             CDS       T01003                                 

Gene name
Slc6a2, Net
Definition
(RefSeq) solute carrier family 6 member 2
  KO
K05035  solute carrier family 6 (neurotransmitter transporter, noradrenalin) member 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    83511 (Slc6a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    83511 (Slc6a2)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   83511 (Slc6a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF
Motif
Other DBs
NCBI-GeneID: 83511
NCBI-ProteinID: NP_112633
RGD: 621822
Ensembl: ENSRNOG00000016311
UniProt: Q9WTR4
Position
19p11
AA seq 597 aa AA seqDB search
MVTRTRETWGKKIDFLLSVVGFAVDLANVWRFPYLCYKNGGGAFLIPYTLFLIIAGMPLF
YMELALGQFNREGAATVWKICPFFKGVGYAVILIALYVGFYYNVIIAWSLYYLFASFTLN
LPWTNCGHAWNSPNCTDPKLLNASVLGDHTKYSKYKFTPAAEFYERGVLHLHESSGIHDI
GLPQWQLLLCLMVVIVVLYVSLWKGVKTSGKVVWITATLPYFVLFVLLVHGVTLPGASNG
INAYLHIDFYRLKEATVWIDAATQIFFSLGAGFGVLIAFASYNKFDNNCYRDALLTSTIN
CVTSFISGFAIFSILGYMAHEHKVKIEDVATEGAGLVFVLYPEAISTLSGSTFWAVLFFL
MLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLFTCAVTLGTFLLAMFCITKGGIYVLT
LLDTFAAGTSILFAVLMEAIGVSWFYGVDRFSNDIQQMMGFKPGLYWRLCWKFVSPAFLL
FVVVVSIINFKPLTYDDYVYPPWANWVGWGIALSSMILVPAYVIYKFFSIRGSLWERVAY
GITPENEHHLLALEIELSSLQSFVITSCPIDPLLSSFLFISCQKTLVFKKSGPAPLI
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggtgacgcgcacccgggagacttggggcaagaagattgatttcctgctgtctgtggtg
ggcttcgcagtggacctggccaatgtgtggcgcttcccctatctctgctacaagaatggt
ggtggtgccttcctgattccatatacactgttcctcatcattgctgggatgcctctgttt
tacatggagctggctctggggcagttcaaccgggagggggcagccacagtgtggaagatc
tgccctttcttcaaaggagtgggctatgctgtgatcctcattgccctctatgttggcttt
tactacaatgtcatcatcgcctggtcactgtactacctcttcgcgtccttcaccttgaac
ctgccctggaccaactgtggccatgcctggaacagccccaactgtaccgaccccaaactc
ctcaacgcctcggtgctgggcgaccataccaaatactccaaatacaagttcacaccggct
gcagagttttatgagcgtggtgtcctacaccttcacgagagcagtgggatccatgacatc
ggcctgccccagtggcagctgttgctatgcctgatggtcgttatcgttgtcctgtatgtc
agcctctggaaaggagtgaagacatcgggaaaggttgtctggatcacagccaccctgcct
tactttgtcctctttgtgctcctggttcatggcgtcactctgcctggtgcttccaatggc
atcaacgcctacctgcacattgacttctaccgcctcaaggaggccacggtatggatcgat
gctgcaacccaaatattcttttccctgggagctggatttggagtcttgattgcatttgcc
agttacaataaatttgacaacaactgttacagggatgccttgctgaccagcaccatcaac
tgtgttaccagttttatttctggatttgccattttctccatccttggttacatggcccat
gaacataaagtcaagattgaggatgtcgccactgaaggagctggccttgtatttgtcctg
tatccagaagccatttctactctgtcgggatccacgttctgggctgtcctgttcttcctg
atgctcctggctctggggctagatagctcaatgggaggcatggaggcagtcatcaccgga
ctggctgatgacttccaggtcctgaagcgacaccgaaaactcttcacatgtgctgtcacc
ctcggtacctttcttctggccatgttttgcataacgaagggagggatttacgtcctcact
ctgctggacaccttcgcggcaggcacgtccattctctttgccgtgctcatggaggccatt
ggagtttcctggttttatggcgtggacaggttcagcaatgacatccagcagatgatgggg
tttaagccaggcctgtactggagactgtgttggaagttcgtgagccccgccttcctcctg
tttgtggtagtggtcagcatcatcaacttcaagccactcacctatgatgactacgtctat
cctccttgggccaactgggtcgggtggggcattgccctctcatccatgatcctggtacct
gcctacgtcatctacaaattcttcagcatacggggctccctttgggagagagtggcctac
ggaatcaccccggagaatgagcaccacctattggctctagaaatagagctttccagcctt
cagagctttgttattacttcatgtcccatagatcctcttttgtcgagttttcttttcatc
tcctgccagaaaaccttggtgtttaagaagtcaggtccagcaccattgatttga

DBGET integrated database retrieval system