KEGG   Rattus norvegicus (rat): 83512
Entry
83512             CDS       T01003                                 

Gene name
Fads2, Fadsd6
Definition
(RefSeq) fatty acid desaturase 2
  KO
K10226  acyl-CoA 6-desaturase (Delta-6 desaturase) [EC:1.14.19.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00592  alpha-Linolenic acid metabolism
rno01040  Biosynthesis of unsaturated fatty acids
rno01100  Metabolic pathways
rno01212  Fatty acid metabolism
rno03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    83512 (Fads2)
   01040 Biosynthesis of unsaturated fatty acids
    83512 (Fads2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    83512 (Fads2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rno01004]
    83512 (Fads2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     83512 (Fads2)
Lipid biosynthesis proteins [BR:rno01004]
 Desaturase
  Front-end
   83512 (Fads2)
SSDB
Motif
Pfam: FA_desaturase Cyt-b5
Other DBs
NCBI-GeneID: 83512
NCBI-ProteinID: NP_112634
RGD: 68339
Ensembl: ENSRNOG00000020440
UniProt: Q9Z122
Position
1q43
AA seq 444 aa
MGKGGNQGEGSTELQAPMPTFRWEEIQKHNLRTDRWLVIDRKVYNVTKWSQRHPGGHRVI
GHYSGEDATDAFRAFHLDLDFVGKFLKPLLIGELAPEEPSLDRGKSSQITEDFRALKKTA
EDMNLFKTNHLFFFLLLSHIIVMESIAWFILSYFGNGWIPTVITAFVLATSQAQAGWLQH
DYGHLSVYKKSIWNHIVHKFVIGHLKGASANWWNHRHFQHHAKPNIFHKDPDIKSLHVFV
LGEWQPLEYGKKKLKYLPYNHQHEYFFLIGPPLLIPMYFQYQIIMTMIRRRDWVDLAWAI
SYYARFFYTYIPFYGILGALVFLNFIRFLESHWFVWVTQMNHIVMEIDLDHYRDWFSSQL
AATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLL
RALLDIVSSLKKSGELWLDAYLHK
NT seq 1335 nt   +upstreamnt  +downstreamnt
atggggaagggaggtaaccagggagaggggagcaccgagctccaggctccgatgcccacc
ttccgctgggaggagattcagaagcacaacctgcgcaccgaccggtggctcgtcatcgac
cgcaaggtctacaacgttaccaaatggtcccagcggcacccaggggggcaccgtgtcatc
ggacactattcgggagaagatgctacggatgccttccgtgccttccacctggacctggat
ttcgtgggcaagttcttgaagcccctgctgattggtgagctggccccagaggagcccagc
ctggaccggggcaaaagctctcagatcaccgaggacttcagggccctgaagaagactgct
gaggacatgaaccttttcaaaaccaaccacctgttcttctttctcctcctgtcccacatc
atcgtcatggaaagcatcgcctggttcatcctctcgtacttcggcaatggctggattccc
accgtcatcacggcctttgtccttgctacctcccaggcccaagctggatggctacaacat
gattatggccacctttctgtctataagaaatccatatggaaccacattgtccacaagttt
gtcattggccacttaaagggtgcctccgccaactggtggaaccatcgacatttccagcac
catgcgaagcccaacatcttccacaaggaccccgacataaagagcctgcacgtgtttgtc
cttggagagtggcagcccctcgagtatggcaagaagaagctgaaatatctgccctacaac
caccagcatgaatacttcttcctgatcggaccaccgctgctcatccctatgtacttccag
taccagatcatcatgaccatgatcagacgcagagactgggtggacttggcctgggccatc
agctactatgcacgtttcttctacacctatatccctttctatggcatcttgggagccctg
gttttcctcaactttatcaggttcctggagagccactggtttgtgtgggtcacacagatg
aaccacattgtcatggagattgatcttgatcactaccgggactggttcagcagccagctg
gcagccacctgcaatgtggagcagtccttcttcaatgactggttcagcgggcacctcaat
ttccagattgagcaccacctcttccccactatgccaagacacaacttgcacaagattgcc
ccactggtgaagtctctctgcgccaagcatggcattgaataccaagagaagccgctgctg
agggccctgctcgacattgtgagttcactgaagaagtctggggagctgtggctggatgcc
tacctccacaaatga

DBGET integrated database retrieval system