KEGG   Rattus norvegicus (rat): 83516
Entry
83516             CDS       T01003                                 

Gene name
Ppargc1a
Definition
(RefSeq) peroxisome proliferator-activated receptor gamma coactivator 1-alpha
  KO
K07202  alpha peroxisome proliferator-activated receptor gamma coactivator 1-alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04371  Apelin signaling pathway
rno04714  Thermogenesis
rno04910  Insulin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    83516 (Ppargc1a)
   04152 AMPK signaling pathway
    83516 (Ppargc1a)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    83516 (Ppargc1a)
   04922 Glucagon signaling pathway
    83516 (Ppargc1a)
   04920 Adipocytokine signaling pathway
    83516 (Ppargc1a)
  09149 Aging
   04211 Longevity regulating pathway
    83516 (Ppargc1a)
  09159 Environmental adaptation
   04714 Thermogenesis
    83516 (Ppargc1a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    83516 (Ppargc1a)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    83516 (Ppargc1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    83516 (Ppargc1a)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    83516 (Ppargc1a)
SSDB
Motif
Pfam: RRM_1 Tox-ODYAM1
Other DBs
NCBI-GeneID: 83516
NCBI-ProteinID: NP_112637
RGD: 620925
Ensembl: ENSRNOG00000004473
UniProt: Q9QYK2
Position
14
AA seq 796 aa
MAWDMCSQDSVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGLKWCSDQS
EIISNQYNNEPANIFEKIDEENEANLLAVLTETLDSLPVDEDGLPSFDALTDGDVTTDNE
ASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNECSGLSTQNHANHTHRIRTNPAI
VKTENSWSNKAKSICQQQKPQRRPCSELLKYLTTNDDPPHTKPTENRNSSRDKCASKKKS
HTQPQSQHAQAKPTTLSLPLTPESPNDPKGSPFENKTIERTLSVELSGTAGLTPPTTPPH
KANQDNPFKASPKLKPSCKTVVPPPTKRARYSECSGTQGSHSTKKGPEQSELYAQLSKSS
VLSRGHEERKTKRPSLRLFGDHDYCQSVNSKTDILINISQELQDSRQLDFKDASCDWQGH
ICSSTDSSQCYLRETLEASKQVSPCSTRKQLQDQEIRAELNKHFGHPSQAVFDDKVDKTS
ELRDGNFSNEQFSKLPVFINSGLAMDGLFDDSEDENDKLSYPWDGTQSYSLFDVSPSCSS
FNSPCRDSVSPPKSLFSQRPQRMRSRSRSFSRHRSCSRSPYSRSRSRSPGSRSSSRSCYY
YESSHYRHRTHRNSPLYVRSRSRSPYSRRPRYDSYEANEHERLKRDEYRREYEKRESERA
KQRERQKQKAIEERRVIYVGKIRPDTTRTELRDRFEVFGEIEECTVNLRDDGDSYGFITY
RYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDS
LDFDSLLKEAQRSLRR
NT seq 2391 nt   +upstreamnt  +downstreamnt
atggcttgggacatgtgcagccaagactctgtatggagtgacatagagtgtgctgccctg
gttggtgaggaccagcctctttgcccagatcttcctgaacttgacctttctgaacttgat
gtgaatgacctggacacagacagctttctgggtggattgaagtggtgtagtgaccaatca
gaaatcatatccaaccagtacaacaatgagcccgcgaacatattcgagaagatagatgaa
gagaatgaggcaaacttgctagcggtcctcacagagacactggacagtctcccggtggat
gaagacggattgccctcatttgatgcactgacagatggagacgtgaccactgacaacgag
gccagtccttcctccatgcctgacggcacccctccccctcaggaggcagaagagccgtct
ctacttaagaagctcttactggcgccagccaacactcagctcagctacaatgaatgcagc
ggtcttagcactcagaaccatgcaaaccacacccacaggatcagaacaaaccctgccatt
gttaagaccgagaattcatggagcaataaagcaaagagcatttgtcaacagcaaaagcca
caaagacgtccctgctcagagcttctcaagtatctgaccacaaacgatgaccctcctcac
accaaacccacagagaacagaaacagcagcagagacaaatgtgcttccaaaaagaagtcc
catacacaaccgcagtcgcaacatgctcaagccaaaccaacaactttatctcttcctctg
accccagagtcaccaaatgaccccaagggttccccatttgagaacaagactattgagcga
accttaagtgtggaactctctggaactgcaggcctaactcctcccacgactcctcctcat
aaagccaaccaagataaccctttcaaggcttcgccaaagctgaagccctcttgcaagacc
gtggtgccaccaccaacaaagagggcccggtacagtgagtgttctggtacccaaggcagc
cactccaccaagaaagggccggagcaatctgagttatacgcacaactcagcaagtcctca
gtgctcagccgaggacacgaggaaaggaagactaaacggcccagtctacggctgtttggt
gatcatgactactgtcagtcagtcaattccaaaacggatatactcattaacatatcacag
gagctccaagactctagacaactagacttcaaagatgcctcctgtgactggcaggggcac
atctgttcttccacagattcaagccagtgctacctgagagagactttggaggccagcaag
caggtctctccttgcagcaccagaaaacagctccaagaccaggaaatccgagctgagctg
aacaagcacttcggtcatcccagtcaagctgtttttgacgacaaagtagacaagaccagt
gaactacgggatggcaacttcagtaatgaacaattctccaaactacctgtgtttataaat
tcaggactagccatggatggcctatttgatgacagtgaagatgaaaatgataaactgagc
tacccttgggatggcacgcagtcctattcattgttcgatgtgtcgccttcttgctcttcc
tttaactctccgtgtcgagattcagtgtcaccaccgaaatccttattttctcaaagaccc
caaaggatgcgctctcgttcgagatccttttctcgacacaggtcgtgttcccgatcacca
tattccaggtcaagatcaaggtccccaggcagtagatcctcttcaagatcctgttactat
tatgaatcaagccactacagacaccgcacacatcgcaattctcccttgtatgtgagatca
cgttcaaggtcaccctacagccgtaggcccaggtatgacagctatgaagccaatgagcac
gaaaggctcaagagggacgaataccgcagagagtatgagaagcgggagtctgaaagggcc
aagcagagagagaggcagaagcagaaagcaattgaagagcgccgtgtgatttacgttggt
aaaatcagacctgacacaacgcggacagaactgagagaccgctttgaagtttttggtgaa
attgaggaatgcaccgtaaatctgcgggatgatggagacagctatggtttcattacctac
cgttacacctgtgacgctttcgctgctcttgagaatggatatactttacgcaggtcgaat
gaaactgacttcgagctgtacttttgtggacggaagcaatttttcaagtctaactatgca
gacctagattcaaactcagacgattttgaccctgcttccaccaagagcaagtatgactct
ctggattttgatagtttactgaaggaagctcagagaagcttgcgcaggtaa

DBGET integrated database retrieval system