KEGG   Rattus norvegicus (rat): 83518Help
Entry
83518             CDS       T01003                                 

Gene name
Aplnr, Agtrl1, Apj
Definition
(RefSeq) apelin receptor
  KO
K04174  apelin receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    83518 (Aplnr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    83518 (Aplnr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    83518 (Aplnr)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Apelin
    83518 (Aplnr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7tm_4 TAS2R 7TM_GPCR_Srw
Motif
Other DBs
NCBI-GeneID: 83518
NCBI-ProteinID: NP_112639
RGD: 621645
Ensembl: ENSRNOG00000009227
UniProt: Q9JHG3
Position
3q24
AA seq 377 aa AA seqDB search
MEDDGYNYYGADNQSECDYADWTPSGALIPAIYILVFLLGTTGNGLVLWTVFWSSREKRR
SADIFIASLAVADLTFVVTLPLWATYTYREFDWPFGTFSCKLSSYLIFVNMYASVFCLTG
LSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAVPVMVFRSTDIPENSTKTQCY
MDYSMVATSNSEWAWEVGLGVSSTAVGFVVPFIIMLTCYFFIAQTIAGHFRKERIEGLRK
RRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGNLLHWPCDFDSFLMNVFPYCTCISYVNS
CLNPFLYAFFDPRFRRACTSMLCCDQSGCKGSPHSSSAEKSASYSSGHSQGPGPNMCKGG
EPMHEKSIPYSQETLVD
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggaagatgatggttacaactactacggggctgacaaccagtctgaatgtgactacgca
gactggacgccctctggagctctcatccctgccatctacattctggttttccttctaggc
accacaggcaatggcctggtgctctggaccgtgttttggagcagccgagaaaagagacgc
tcagctgacatcttcattgccagcctggctgtggctgacttgacctttgtggtgactttg
ccactgtgggccacttatacctaccgggagtttgactggccttttggaaccttctcttgc
aagctcagcagctacctcatctttgtcaacatgtacgccagtgtcttttgcctcaccggc
ctcagctttgaccgatacctggccattgtcaggccagtggctaacgctcgactaaggctg
cgagtcagcggggccgtggccacagcagtcttgtgggtgctggctgcccttctagctgtg
cccgtcatggtgttccgttccactgacatcccggaaaacagcaccaagacccagtgctac
atggactactctatggtggccacttcaaactcagagtgggcctgggaggtgggccttggg
gtgtcctccactgctgtgggctttgtggtgcccttcatcatcatgctgacctgttacttc
ttcattgcccaaaccatcgctggccatttccgaaaggagcgcatcgagggcctgcggaag
aggcgccggctgctgagcatcatcgtggtgctggtggtgacctttgccctgtgctggatg
ccttaccacctggtgaagactctctacatgctgggcaatttgctgcactggccctgtgac
tttgacagcttcctcatgaatgtctttccctattgcacctgcatcagttacgtcaacagc
tgcctcaaccccttcctctatgccttctttgacccccgatttcgccgagcctgcacctcc
atgctctgctgtgaccagagcgggtgcaaaggcagccctcacagcagcagtgcagagaaa
tctgccagttattcttctgggcacagccagggccccggccccaacatgtgcaagggagga
gaaccgatgcatgagaaatctatcccctatagccaagaaacccttgtggactag

DBGET integrated database retrieval system