KEGG   Rattus norvegicus (rat): 83526Help
Entry
83526             CDS       T01003                                 

Gene name
Atrn
Definition
(RefSeq) attractin
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Kelch_1 Lectin_C Kelch_6 PSI Kelch_5 Kelch_2 CUB Kelch_4 Laminin_EGF EGF_2 TMEM100
Motif
Other DBs
NCBI-GeneID: 83526
NCBI-ProteinID: NP_112641
RGD: 69063
Ensembl: ENSRNOG00000021240
UniProt: Q99J86
Position
3q36
AA seq 1432 aa AA seqDB search
MVAAAAAAEATEARLRGYTTATAAPAGWKERQHRPCAATGAWRPWPRAGLCLPRVLSRAL
SPPPLLPLLPLLFSLLLLPLPREAEAAAVAAAVSGSAAAEAKECDRPCVNGGRCNPGTGQ
CVCPTGWVGEQCQHCGGRFRLTGSSGFVTDGPGNYKYKTKCTWLIEGQPNKIMRLRFNHF
ATECSWDHLYVYDGDSIYAPLIAAFSGLIVPERDGNETAPEVTVTSGYALLHFFSDAAYN
LTGFNITYNFDMCPNNCSGRGECKSSNSSSTVECECSENWKGESCDIPHCTDNCGFPHRG
ICNASDTRGCSCFPHWQGPGCSIPVPANQSFWTREEYSDLKLPRASHKAVVNGNIMWVVG
GYMFNHSDYSMVLAYDLASREWLSLNHSVNSVVVRYGHSLALHKDKIYMYGGKIDSTGNV
TNELRVFHIHNESWVLLTPKAKDQYAVVGHSAHIVTLSSGRVVMLVIFGHCPLYGYISVV
QEYDLEKNTWSILQTQGALVQGGYGHSSVYDHRTKALYVHGGYKAFSANKYRLADDLYRY
HVDTQMWTILKDSRFFRYLHTAVIVSGTMLVFGGNTHNDTSMSHGAKCFSSDFMAYDIAC
DRWSVLPRPELHHDVNRFGHSAVLHNSTMYVFGGFNSLLLSDVLVFTSEQCDAHRSEAAC
VAAGPGIRCLWDTQSSRCTSWELATEEQAEKLKSECFSKRTLDHDRCDQHTDCYSCTANT
NDCHWCNDHCVPVNHSCTEGQISIAKYDNCPKDNPMYYCNKKTSCRSCALDQNCQWEPRN
QECIALPENICGIGWHLVGNSCLKITTAKENYDNAKLSCRNHNAFLASLTSQKKVEFVLK
QLRLMQSSQSTSKLTLTPWVGLRKINVSYWCWEDMSPFTNSLLQWMPSEPSDAGFCGILS
EPSTRGLKAATCINPLNGSVCERPANHSAKQCRTPCALRTACGECTSSSSECMWCSNMKQ
CVDSNAYVASFPFGQCMEWYTMSSCPPENCSGYCTCSHCLEQPGCGWCTDPSNTGKGKCI
EGSYKGPVKMPSHASTGNVYPQPLLNSSMCLEDSRYNWSFIHCPACQCNGHSKCINQSIC
EKCEDLTTGKHCETCISGFYGDPTNGGKCQPCKCNGHASLCNTNTGKCFCTTKGVKGEEC
QLCEVENRYQGNPLKGTCYYTLLIDYQFTFSLSQEDDRYYTAINFVATPDEQNRDLDMFI
NASKNFNLNITWATSFPAGTQTGEEVPVVSKTNIKEYKDSFSNEKFDFRNHPNITFFVYV
SNFTWPIKIQIAFSQHSNFMDLVQFFVTFFSCFLSLLLVAAVVWKIKQSCWASRRREQLL
REMQQMASRPFASVNVALETDEEPPDLIGGSIKTVPKPIALEPCFGNKAAVLSVFVRLPR
GLGGIPPPGQSGLAVASALVDISQQMPIVYKEKSGAVRNRKQQPPAQPGTCI
NT seq 4299 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggcggcggcggcggcggaggcgactgaggcgcggttgagggggtacacgacg
gcgacagcagcgcccgcgggctggaaggagaggcagcaccgaccctgcgccgcgacaggg
gcctggaggccgtggccgcgcgccgggctgtgtctcccgcgggtgctgtcgcgggcgcta
tccccgccgccgctgctgccgctgctgccgctgctcttttcgctattgctgctgccactg
ccccgggaggccgaggccgctgcggtggcggcggctgtgtcaggctcggccgcagctgag
gccaaggaatgtgaccggccgtgtgtcaacggcggccgctgcaaccctggcaccggccag
tgcgtctgccccacgggctgggtgggcgagcaatgccagcactgcgggggccgcttcaga
ctaactggatcttctggatttgtaacagatggacctgggaattataaatataaaacgaaa
tgcacatggctcattgaaggacagccaaataagataatgagacttcgattcaaccatttt
gctactgaatgtagctgggaccatttatatgtttatgatggggactcaatttacgcacct
ctgattgctgcctttagtggcctcattgttcctgaaagagatggcaatgagacggcccct
gaagtcactgtcacttcaggttatgcactactgcattttttcagtgatgctgcttataat
ctgactggatttaatatcacttacaattttgacatgtgcccgaataattgctcaggccga
ggagaatgtaagagcagtaacagcagcagcactgttgagtgtgaatgttctgaaaactgg
aaaggggagtcctgtgacattcctcactgtacagacaactgtggctttcctcaccgaggc
atctgtaacgcaagtgacaccagagggtgctcctgcttccctcactggcagggtcctgga
tgttcaattcctgtgccagctaaccagtctttttggactcgagaagaatattctgactta
aagcttcccagagcctctcataaagctgtggtcaatggaaatataatgtgggttgttggc
gggtatatgttcaaccattcagattacagcatggttttagcgtatgacctggcttctagg
gaatggctttcactaaaccattctgtgaacagtgtggttgtaagatatggtcattctttg
gcattacataaggataaaatctacatgtatggaggaaaaattgattcaacagggaatgtg
accaacgagctgagagtatttcatattcataatgaatcatgggtattgttaacccccaaa
gctaaggatcagtatgcagtggttggacactcagcacacattgttacactgtcatctggc
cgtgtggtcatgttggtcatcttcggtcattgtccgctctacggatatataagtgttgtg
caggaatatgacttggaaaagaacacatggagtatattacaaactcaaggtgctctagtg
caagggggttatggccacagcagtgtttatgatcacaggaccaaggctctgtatgttcat
ggtggctacaaggctttcagcgccaacaagtaccggcttgcagatgacctctacagatac
catgtggacactcagatgtggaccattcttaaggacagccgatttttccgttacttgcat
acagctgtgatagtgagtggaaccatgctggtgttcggagggaacacacacaatgacact
tccatgagccacggtgccaaatgcttctcctcagacttcatggcttatgacattgcttgt
gaccgatggtcagttctccccagacctgagctccatcacgatgtcaaccgatttggccac
tcagcagtcttgcacaacagcaccatgtatgtgttcggcggcttcaacagcctcctcctc
agtgacgtcttagtcttcacctcggagcagtgtgatgcacaccgcagcgaagctgcttgt
gtggcagcaggacctggcatccggtgtctgtgggacacacagtcgtctcgatgtacctcc
tgggagttggcaactgaagaacaagcagaaaagttaaaatcagaatgtttctctaaaaga
acccttgaccatgacagatgtgaccagcacacagattgttacagctgcacagccaatacc
aatgactgccactggtgcaatgatcactgtgtccctgtgaaccacagctgcacagaaggc
cagatctccattgccaagtatgacaattgccccaaggataaccccatgtactactgcaat
aagaaaaccagctgcaggagctgtgccctagatcagaattgccagtgggaacctcgaaat
caagagtgcatcgccctgcccgaaaacatctgtggcattggctggcatttggtcggaaac
tcgtgtctgaaaatcactactgctaaggaaaattatgacaatgctaaattgtcctgtaga
aaccacaatgcctttttggcttcgcttacgtcccagaagaaggtggagtttgtccttaag
cagcttcgattaatgcaatcatctcagagcacgtccaagctcactctgactccatgggtt
ggtcttcggaagatcaatgtatcttactggtgctgggaggatatgtctccattcacaaat
agtttgctgcagtggatgccatctgagcccagtgatgccggcttctgtgggatcttgtca
gagcctagtactcggggactgaaggctgcaacctgcatcaacccactcaatggaagtgtt
tgtgaaaggcctgcaaaccacagtgccaagcagtgccggacaccctgtgccctgcggaca
gcatgtggtgagtgcaccagcagcagctccgaatgcatgtggtgcagcaacatgaagcag
tgcgtagactccaatgcctacgtagcctcctttcctttcggccagtgtatggagtggtat
acaatgagcagctgcccacctgaaaattgctctggctactgtacctgcagccattgcttg
gagcagccaggctgtggttggtgtactgatcctagcaatactgggaaaggcaaatgtatt
gagggaagctataaaggacccgtgaagatgccttcacatgcctctacaggaaatgtgtac
ccacagccccttctgaactccagcatgtgtctagaggacagcagatacaactggtctttt
attcactgtccagcttgccagtgcaatggacacagcaagtgcatcaaccagagcatctgt
gagaagtgtgaggacctgaccacaggcaagcactgcgagacctgcatatctggcttctat
ggtgacccgactaatggaggcaaatgtcagccatgcaagtgcaacgggcacgcatcactg
tgcaacaccaacactggcaagtgcttctgtaccaccaagggcgtcaagggagaggagtgc
cagctatgtgaggtagaaaatcgataccagggaaaccctctcaaaggaacatgttactat
acccttctcattgactatcagttcacttttagcctgtcccaggaagacgaccgctattac
acagccatcaattttgtggctactcctgatgaacaaaacagggatttggacatgttcatc
aatgcctccaaaaacttcaacctcaacatcacctgggccaccagtttcccagctggaacc
cagactggagaagaggtgcctgttgtttcaaaaaccaacatcaaggaatacaaagatagc
ttctctaatgagaaatttgattttcgcaaccatccaaacattactttctttgtttatgtc
agtaatttcacttggcccatcaaaattcaaattgccttctcccagcacagcaattttatg
gacctggtgcagttcttcgtgactttcttcagctgtttcctctctctgcttctggtggcg
gcagtggtctggaagatcaagcagagctgttgggcatccaggaggagagagcaacttctt
cgggagatgcaacagatggccagccgcccttttgcttctgtaaatgttgccttggaaaca
gatgaagaacctcctgatctcattgggggaagtataaagactgttcctaagcccattgcc
ctggagccctgctttggtaacaaagctgctgtcctctctgtgtttgtgaggctccctcga
ggactgggaggaatccctcctcctggtcagtcaggtcttgctgtggccagtgccctggtg
gacatttctcagcagatgccaatagtgtacaaggagaagtcaggagctgtaaggaaccgg
aagcagcagccccctgcacagcctggaacctgcatttga

DBGET integrated database retrieval system