KEGG   Rattus norvegicus (rat): 83529
Entry
83529             CDS       T01003                                 

Gene name
Vdac1
Definition
(RefSeq) voltage-dependent anion channel 1
  KO
K05862  voltage-dependent anion channel protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04217  Necroptosis
rno04218  Cellular senescence
rno04621  NOD-like receptor signaling pathway
rno04979  Cholesterol metabolism
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05164  Influenza A
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    83529 (Vdac1)
   04022 cGMP-PKG signaling pathway
    83529 (Vdac1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    83529 (Vdac1)
   04218 Cellular senescence
    83529 (Vdac1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    83529 (Vdac1)
  09154 Digestive system
   04979 Cholesterol metabolism
    83529 (Vdac1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    83529 (Vdac1)
   05012 Parkinson disease
    83529 (Vdac1)
   05014 Amyotrophic lateral sclerosis
    83529 (Vdac1)
   05016 Huntington disease
    83529 (Vdac1)
   05017 Spinocerebellar ataxia
    83529 (Vdac1)
   05020 Prion disease
    83529 (Vdac1)
   05022 Pathways of neurodegeneration - multiple diseases
    83529 (Vdac1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    83529 (Vdac1)
   05164 Influenza A
    83529 (Vdac1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    83529 (Vdac1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    83529 (Vdac1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    83529 (Vdac1)
Ion channels [BR:rno04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   83529 (Vdac1)
SSDB
Motif
Pfam: Porin_3
Other DBs
NCBI-GeneID: 83529
NCBI-ProteinID: NP_112643
RGD: 621575
Ensembl: ENSRNOG00000006375
UniProt: Q9Z2L0
Position
10q22
AA seq 283 aa
MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVNGSLET
KYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKR
EHINLGCDVDFDIAGPSIRGALVLGYEGWLAGYQMNFETSKSRVTQSNFAVGYKTDEFQL
HTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQVDPDACFSAKVNNS
SLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
NT seq 852 nt   +upstreamnt  +downstreamnt
atggctgtgcctcccacatatgctgatcttggcaagtccgccagggatgtcttcaccaag
ggctacggctttggcttaataaaacttgatttgaaaacgaagtccgagaatggattggaa
tttactagctcaggttctgccaacacggagaccaccaaagtgaacggcagtctggaaacc
aagtacagatggaccgagtatgggctgacgtttactgagaagtggaacacagacaacacc
ctgggcactgagatcaccgtggaagaccagcttgctcgtggactgaagctgacctttgat
tcatctttctcgcctaacactgggaaaaaaaatgctaaaatcaagacagggtacaagagg
gagcatatcaacctgggctgtgatgtggactttgacatcgctgggccctcaatccggggc
gctctggtgcttggctatgagggttggctggctggctaccagatgaattttgagacctcg
aagtcccgagtgacccagagcaactttgcagttggctacaagacggacgaattccagctt
catactaatgtgaatgatgggacggagtttggtggctccatttaccagaaggtgaacaag
aagttggagactgctgtcaatctcgcctggaccgcaggaaacagtaacactcgctttgga
atagcagccaagtatcaggtcgaccctgatgcctgcttttcggccaaagtgaacaactcc
agtctaattggcttagggtacactcagaccctaaaaccaggtatcaaactgacactgtca
gccctgctggatggcaagaacgtcaatgcgggtggccacaagcttggtttaggactggaa
tttcaagcataa

DBGET integrated database retrieval system