KEGG   Rattus norvegicus (rat): 83532
Entry
83532             CDS       T01003                                 

Gene name
Vdac3
Definition
(RefSeq) voltage-dependent anion-selective channel protein 3
  KO
K15041  voltage-dependent anion channel protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04216  Ferroptosis
rno04217  Necroptosis
rno04218  Cellular senescence
rno04613  Neutrophil extracellular trap formation
rno04621  NOD-like receptor signaling pathway
rno04979  Cholesterol metabolism
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05161  Hepatitis B
rno05166  Human T-cell leukemia virus 1 infection
rno05203  Viral carcinogenesis
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    83532 (Vdac3)
   04022 cGMP-PKG signaling pathway
    83532 (Vdac3)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    83532 (Vdac3)
   04217 Necroptosis
    83532 (Vdac3)
   04218 Cellular senescence
    83532 (Vdac3)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    83532 (Vdac3)
   04621 NOD-like receptor signaling pathway
    83532 (Vdac3)
  09154 Digestive system
   04979 Cholesterol metabolism
    83532 (Vdac3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    83532 (Vdac3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    83532 (Vdac3)
   05161 Hepatitis B
    83532 (Vdac3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    83532 (Vdac3)
   05012 Parkinson disease
    83532 (Vdac3)
   05016 Huntington disease
    83532 (Vdac3)
   05017 Spinocerebellar ataxia
    83532 (Vdac3)
   05020 Prion disease
    83532 (Vdac3)
   05022 Pathways of neurodegeneration - multiple diseases
    83532 (Vdac3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    83532 (Vdac3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    83532 (Vdac3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    83532 (Vdac3)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    83532 (Vdac3)
Ion channels [BR:rno04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   83532 (Vdac3)
SSDB
Motif
Pfam: Porin_3
Other DBs
NCBI-GeneID: 83532
NCBI-ProteinID: NP_112645
RGD: 621577
Ensembl: ENSRNOG00000019277
UniProt: Q9R1Z0
Position
16
AA seq 283 aa
MCSTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLET
KYKVCNYGLIFTQKWNTDNTLGTEISWENKLAEGLKLTVDTIFVPNTGKKSGKLKASYRR
DCFSVGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLCQNNFALGYKAEDFQL
HTHVNDGTEFGGSIYQRVNEKIETSINLAWTAGSNNTRFGIAAKYRLDCRTSLSAKVNNA
SLIGLGYTQSLRPGVKLTLSALVDGKNFNAGGHKVGLGFELEA
NT seq 852 nt   +upstreamnt  +downstreamnt
atgtgtagcacaccaacttactgcgacctaggaaaggctgccaaggatgtctttaacaaa
gggtatgggtttggcatggtcaaaatagatctgaaaaccaagtcttgtagtggagtggaa
ttttctacttctggtcatgcttatactgatacagggaaagcatcaggcaacctagagacc
aaatataaggtctgtaactacgggctcatcttcacccaaaagtggaatacagacaatact
cttgggacagaaatctcttgggagaataagttggctgaagggttgaaactgacggttgat
accatatttgtaccaaacacagggaagaagagtgggaaattaaaggcctcctatagacgg
gattgttttagtgtgggcagtaacgttgacatagatttttctggaccgaccatctatggc
tgggccgtgttggcctttgaaggttggcttgctggctaccagatgagttttgacacagcc
aaatccaaactgtgtcagaataattttgctcttggttacaaggctgaagacttccaactg
catactcatgtaaacgatggcactgaatttggaggctccatctaccagagagttaatgag
aagatcgaaacatcaataaacctggcatggacagctggcagcaacaacactcgttttggc
atcgctgctaagtataggctggattgtagaacttctctgtctgccaaagtaaacaatgcc
agtttaattggactgggttatacgcagagtctccgaccgggagtcaaactgaccctgtca
gctttagtggatggaaagaacttcaatgcaggaggccacaaggttggcttgggatttgaa
ctggaagcttaa

DBGET integrated database retrieval system