KEGG   Rattus norvegicus (rat): 83534
Entry
83534             CDS       T01003                                 

Gene name
Tpp1
Definition
(RefSeq) tripeptidyl-peptidase 1 precursor
  KO
K01279  tripeptidyl-peptidase I [EC:3.4.14.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    83534 (Tpp1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    83534 (Tpp1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    83534 (Tpp1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    83534 (Tpp1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.9  tripeptidyl-peptidase I
     83534 (Tpp1)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S53
   83534 (Tpp1)
Chaperones and folding catalysts [BR:rno03110]
 Intramolecular chaperones
  Subtilisin family
   83534 (Tpp1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   83534 (Tpp1)
SSDB
Motif
Pfam: Pro-kuma_activ Peptidase_S8
Other DBs
NCBI-GeneID: 83534
NCBI-ProteinID: NP_112647
RGD: 621296
Ensembl: ENSRNOG00000019212
UniProt: Q9EQV6
Position
1
AA seq 563 aa
MGLQARFLGLLALVIAGKCTHSPEPDQRWMLPPGWVSLGRVDPEEELSLTFALKQQNLDR
LSELVQAVSDPSSPRYGKYLTLEDVAELVQPSPLTLCTVQKWLLAAGARDCHSVTTQDFL
TCWLSVRQAELLLPGAEFHRYVGGPAKTHIIRSPHPYQLPQALAPHVDFVAGLHRFPPLS
SPRQRPEPQGVGPVGLHLGVTPSVLRQRYNLTARDVGSGTTNNSQACAQFLEQYFHNSDL
TEFMRLFGSSFAHQASVARVVGKQGRGRAGIEASLDVEYLMSAGANISTWVYSSPGRHEA
QEPFLQWLLLLSNESSLPHVHTVSYGDDEDSLSSVYIQRVNTEFMKAAARGLTLLFASGD
TGAGCWSVSGRHKFRPSFPASSPYVTTVGGTSFKNPFLVTNEVVDYISGGGFSNVFPQPS
YQEEAVAQFLKSSSHLPPSSYFNASGRAYPDVAALSDGYWVVSNMVPIPWVSGTSASTPV
FGGILSLINEHRLLNGRPPLGFLNPRLYQQHGAGLFDVTHGCHESCLNEEVEGQGFCSGP
GWDPVTGWGTPNFPALLKTLLNP
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgggactccaagcccgcttcctaggactccttgctctcgtcatcgccggcaaatgcact
cacagccccgagccggaccaacggtggatgctgcctccaggctgggtgtcactgggccga
gtggatcccgaggaagagctgagtcttacttttgcgctgaaacagcagaacctggacaga
ctctcggagctggtgcaggctgtgtcggatcccagctctcctcgatatggaaagtacctc
accctagaggatgtagctgagctggtccaaccatcaccactgaccctctgcactgtccaa
aagtggctcttggcagctggagcccgggactgccattcagtgaccacccaggactttctg
acttgctggctgagtgtccggcaggctgagctgctgcttcctggggctgagtttcatcgc
tatgtagggggacctgcaaagacccacattataaggtccccacatccctatcagctcccc
caggccttggcccctcatgtggactttgtggcggggctgcaccgtttcccccctttatca
tctccgagacaacgtccagagccacaaggagtgggacctgttggcctgcacctgggagtg
actccatctgtgcttcgtcagcgatataacctgacagcccgagatgtgggctctggcacc
accaacaatagccaggcctgtgcccagttcctggaacagtacttccataactcggatctg
actgagttcatgcgcctgtttggtagcagttttgcacaccaggcctcagtagcaagagtg
gttggaaagcaggggcgaggccgagcgggcatcgaggccagtctagatgtggaatacctg
atgagtgctggtgccaatatctccacttgggtctacagtagccctggccgccatgaggca
caggagcccttcttacaatggctcctgcttcttagcaatgagtcatccttgccgcatgta
catactgtgagttacggagacgatgaagactccctcagcagtgtctacatccagagagtc
aacactgagttcatgaaggctgctgctcggggtctcaccctcctttttgcctcaggtgac
actggagctgggtgttggtctgtctccggaagacacaagttccgtcctagcttccctgct
tctagcccctatgtcactacagtaggaggaacctccttcaagaatcctttccttgtcaca
aatgaagtagttgactatatcagtggtggaggcttcagcaatgttttcccacagccttca
taccaggaggaagcagtagcccagttcttgaagtccagctctcatctaccaccatctagt
tacttcaatgctagtggccgtgcttacccagatgttgccgcgctttctgatggctactgg
gtggtcagcaacatggtccccattccgtgggtatctggaacctcggcctctactccagtg
tttgggggaattttatccttgataaatgagcacagactcctcaatggccgcccccctcta
ggctttctcaatcccaggctctatcagcagcatggggcaggactctttgatgtaacccat
ggctgccatgagtcctgtctgaatgaagaagtggagggtcagggtttctgctctggtcct
ggctgggatcctgtgacaggttggggaacacccaacttcccagccctactgaagactcta
ctcaacccttga

DBGET integrated database retrieval system