KEGG   Rattus norvegicus (rat): 83537
Entry
83537             CDS       T01003                                 

Symbol
Smpd2
Name
(RefSeq) sphingomyelin phosphodiesterase 2
  KO
K12351  sphingomyelin phosphodiesterase 2 [EC:3.1.4.12]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    83537 (Smpd2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    83537 (Smpd2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.12  sphingomyelin phosphodiesterase
     83537 (Smpd2)
SSDB
Motif
Pfam: Exo_endo_phos
Other DBs
NCBI-GeneID: 83537
NCBI-ProteinID: NP_112650
RGD: 619753
Ensembl: ENSRNOG00000000306
UniProt: Q9ET64
Position
20
AA seq 422 aa
MKHNFSLRLRVFNLNCWDIPYLSKHRADRMKRLGDFLNLESFDLALLEEVWSEQDFQYLK
QKLSLTYPDAHYFRSGIIGSGLCVFSRHPIQEIVQHVYTLNGYPYKFYHGDWFCGKAVGL
LVLHLSGLVLNAYVTHLHAEYSRQKDIYFAHRVAQAWELAQFIHHTSKKANVVLLCGDLN
MHPKDLGCCLLKEWTGLRDAFVETEDFKGSEDGCTMVPKNCYVSQQDLGPFPFGVRIDYV
LYKAVSGFHICCKTLKTTTGCDPHNGTPFSDHEALMATLCVKHSPPQEDPCSAHGSAERS
ALISALREARTELGRGIAQARWWAALFGYVMILGLSLLVLLCVLAAGEEAREVAIMLWTP
SVGLVLGAGAVYLFHKQEAKSLCRAQAEIQHVLTRTTETQDLGSEPHPTHCRQQEADRAE
EK
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgaagcacaacttttctctgcggctgagggttttcaacctcaactgctgggacatcccc
tacctaagcaagcatagggccgaccgcatgaagcgcttgggagactttctgaacttggag
agctttgacctggctctgctggaggaggtgtggagtgagcaggacttccagtacttaaag
caaaagctatcgctcacctacccggatgcacactacttcagaagcggaatcattggcagt
ggcctctgtgtgttctccagacacccaatccaggaaattgtccagcacgtctatactctc
aatggttacccctacaagttctatcatggagactggttctgtgggaaggctgtggggctg
ctggtgctccatctaagcggactggtgctcaacgcctacgtgacccatctgcacgctgag
tacagccggcagaaggatatctacttcgcacaccgtgtggcccaagcttgggaactggcc
cagttcatccaccacacatccaagaaagcaaatgtggtcctgttgtgcggggatctcaac
atgcaccccaaagacctgggctgctgcctactgaaagagtggacggggctccgtgatgcc
tttgttgagaccgaggactttaagggctcagaggacggctgtaccatggtacccaagaac
tgctacgtcagccagcaggacctggggccgtttccctttggcgtccgtatcgactacgtg
ctttacaaggcagtctctggcttccacatctgctgtaagactctgaaaaccactacgggc
tgtgacccccacaatggcacccccttctctgaccacgaggccctcatggctactttgtgt
gtgaagcacagcccccctcaggaagacccttgctctgcccatggatcagcggaaaggtca
gcattgatcagcgcgctaagggaggcgaggacagagctggggcgaggcatagctcaagct
cgctggtgggctgcactctttggctatgtgatgattttggggctgtccctcctggtgttg
ctgtgtgtcctggctgcaggagaagaggccagggaagtggccataatgctctggacaccc
agtgtgggtctggtgctgggggcaggcgcagtctacctgttccacaagcaggaggccaaa
agcttatgtcgggcccaggctgagatacaacatgttctgacaaggacaacggagacccag
gacctaggctcagagcctcacccaacccactgccggcagcaggaggcggacagagctgaa
gaaaaataa

DBGET integrated database retrieval system