KEGG   Rattus norvegicus (rat): 83567Help
Entry
83567             CDS       T01003                                 

Gene name
Mchr1, Gpr24, Mch-1r, Slc1
Definition
(RefSeq) melanin-concentrating hormone receptor 1
  KO
K04320  melanin-concentrating hormone receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    83567 (Mchr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    83567 (Mchr1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Melanin-concentrating hormone (MCH)
    83567 (Mchr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 83567
NCBI-ProteinID: NP_113946
RGD: 619841
Ensembl: ENSRNOG00000018895
UniProt: P97639
Position
7q34
AA seq 353 aa AA seqDB search
MDLQTSLLSTGPNASNISDGQDNLTLPGSPPRTGSVSYINIIMPSVFGTICLLGIVGNST
VIFAVVKKSKLHWCSNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLIT
AMDANSQFTSTYILTAMTIDRYLATVHPISSTKFRKPSMATLVICLLWALSFISITPVWL
YARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVKILQRMTSSVA
PASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLG
YANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRTVSNAQTADEERTESKGT
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggatctgcaaacctcgttgctgtccactggccccaatgccagcaacatctccgatggc
caggataatctcacattgccggggtcacctcctcgcacagggagtgtctcctacatcaac
atcattatgccttccgtgtttggtaccatctgtctcctgggcatcgtgggaaactccacg
gtcatctttgctgtggtgaagaagtccaagctacactggtgcagcaacgtccccgacatc
ttcatcatcaacctctctgtggtggatctgctcttcctgctgggcatgcctttcatgatc
caccagctcatggggaacggcgtctggcactttggggaaaccatgtgcaccctcatcaca
gccatggacgccaacagtcagttcactagcacctacatcctgactgccatgaccattgac
cgctacttggccaccgtccaccccatctcctccaccaagttccggaagccctccatggcc
accctggtgatctgcctcctgtgggcgctctccttcatcagtatcacccctgtgtggctc
tacgccaggctcattcccttcccagggggtgctgtgggctgtggcatccgcctgccaaac
ccggacactgacctctactggttcactctgtaccagtttttcctggcctttgcccttccg
tttgtggtcattaccgccgcatacgtgaaaatactacagcgcatgacgtcttcggtggcc
ccagcctcccaacgcagcatccggcttcggacaaagagggtgacccgcacggccattgcc
atctgtctggtcttctttgtgtgctgggcaccctactatgtgctgcagctgacccagctg
tccatcagccgcccgaccctcacgtttgtctacttgtacaacgcggccatcagcttgggc
tatgctaacagctgcctgaacccctttgtgtacatagtgctctgtgagacctttcgaaaa
cgcttggtgttgtcagtgaagcctgcagcccaggggcagctccgcacggtcagcaacgct
cagacagctgatgaggagaggacagaaagcaaaggcacctga

DBGET integrated database retrieval system