KEGG   Rattus norvegicus (rat): 83569Help
Entry
83569             CDS       T01003                                 

Gene name
Abcb11, Bsep, Spgp
Definition
(RefSeq) ATP binding cassette subfamily B member 11
  KO
K05664  ATP-binding cassette, subfamily B (MDR/TAP), member 11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno02010  ABC transporters
rno04976  Bile secretion
rno04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    83569 (Abcb11)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    83569 (Abcb11)
   04979 Cholesterol metabolism
    83569 (Abcb11)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    83569 (Abcb11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    83569 (Abcb11)
   04147 Exosome [BR:rno04147]
    83569 (Abcb11)
Transporters [BR:rno02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB11 subgroup
    83569 (Abcb11)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   83569 (Abcb11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N RsgA_GTPase Zeta_toxin AAA_16 AAA_15 AAA_29 AAA_22 ABC_ATPase AAA_30 AAA_21 Rad17
Motif
Other DBs
NCBI-GeneID: 83569
NCBI-ProteinID: NP_113948
RGD: 619930
Ensembl: ENSRNOG00000050860
UniProt: O70127 A0A2P1EA62
Position
3q21
AA seq 1321 aa AA seqDB search
MSDSVILRSVKKFGEENHAFESDGSHNNDKKSRLQDKMKEGDIRVGFFELFRFSSSKDIW
LMLMGGVCALLHGMAQPGILIIFGIMTDIFIKYDIERQELEIPGKACVNNTIVWINSSFH
QNMTNGTVCGLVDIESEMIKFSGIYAGVGMTVLILGYFQIRLWVITGARQIRRMRKIYFR
RIMRMEIGWFDCTSVGELNSRFADDIEKINDAIADQLAHFLQRMSTAMCGLLLGFYRGWK
LTLVILAVSPLIGIGAAVIGLSIAKFTELELKAYAKAGSIADEVLSSIRTVAAFGGENKE
VERYEKNLVFAQRWGIWKGMVMGFFTGYMWCLIFFCYALAFWYGSTLVLDEEEYTPGTLV
QIFLCVILAAMNIGHASSCLEIFSTGCSAATNIFQTIDRQPVIDCMSGDGYKLDRIKGEI
EFHNVTFHYPSRPDVKILDNLSMVIKPGETTALVGSSGAGKSTALQLIQRFYDPCEGMVT
LDGHDIRSLNIRWLRDQIGIVEQEPVLFSTTIAENIRFGREDATMEDIVQAAKDANAYNF
IMALPQQFDTLVGEGGGQMSGGQKQRVAIARALIRNPKILLLDMATSALDNESEARVQEA
LNKIQHGHTIISVAHRLSTVRAADVIIGFEHGVAVERGTHEELLERKGVYFMLVTLQSQG
DNAHKETSIMGKDATEGGTLERTFSRGSYRDSLRASIRQRSKSQLSLLTHDPPLAVADHK
SSYKDSKDNDVLVEEVEPAPVRRILKYNIPEWHYILVGSLSAAINGAVTPIYSLLFSQLL
GTFSLLDKEQQRSEIHSMCLFFVILGCVSIFTQFLQGYTFAKSGELLTKRLRKFGFKAML
GQDIGWFDDLRNNPGVLTTRLATDASQVQGATGSQVGMMVNSFTNIIAALLIAFFFSWKL
SLIITIFFPFLALSGAVQTKMLTGFASQDKQALEKAGQITSEALSNIRTVAGIGVEGRFI
KAFEVELQTSYKTAVRKANIYGLCFAFSQGIAFLANSAAYRYGGYLIAYEGLGFSHVFRV
VSSVALSATAVGRTFSYTPSYAKAKISAARFFQLLDRKPPINVYSEAGEKWDNFQGKIDF
IDCKFTYPSRPDIQVLNGLSVSVNPGQTLAFVGSSGCGKSTSIQLLERFYDPDQGTVMID
GHDSKKVNIQFLRSNIGIVSQEPVLFDCSIMDNIKYGDNTKEISVERAIAAAKQAQLHDF
VMSLPEKYETNVGIQGSQLSRGEKQRIAIARAIVRDPKILLLDEATSALDTESEKTVQTA
LDKAREGRTCIVIAHRLSTIQNSDIIAVVSQGVVIEKGTHEKLMAQKGAYYKLVITGAPI
S
NT seq 3966 nt NT seq  +upstreamnt  +downstreamnt
atgtctgactcagtgattcttcgcagcgtgaagaaatttggagaggagaatcatgctttc
gaatcagatggatcacataacaatgataagaaatcaaggttacaagataagatgaaggag
ggagacattcgagttggcttctttgaactgtttcgattttcttcatcaaaagacatctgg
ctgatgcttatgggaggcgtatgcgcattgctacatggaatggcccagccaggcatactt
attatttttggtataatgacagatatttttattaaatatgacattgaaaggcaagaactc
gagataccaggaaaagcgtgtgtgaataacaccattgtatggatcaacagctccttccac
cagaacatgacaaacggaacagtctgtgggttggtggacattgaaagtgaaatgatcaaa
ttctctggcatctacgcaggagtcggcatgaccgtacttatccttggatactttcaaata
aggttatgggtcatcactggggctcgtcagataaggagaatgaggaaaatttacttccgg
agaataatgagaatggaaattgggtggttcgactgcacttctgtgggagagctgaattca
aggtttgctgatgatattgaaaaaatcaatgacgccattgccgaccagttggctcatttc
ctccagcgcatgtcgacggctatgtgtgggttacttttagggttctacaggggttggaaa
ctaaccttggtgattcttgctgtcagccctctcattggcattggggcagccgtcataggt
ctgagtatagccaagttcacggagcttgagttgaaggcttatgccaaagcggggtctatt
gctgatgaagtcctctcatctattcgaacagtggccgcttttggtggtgagaacaaagag
gttgaaaggtatgagaaaaatcttgtgtttgcccagcgctggggaatttggaaaggaatg
gtgatgggcttcttcactgggtacatgtggtgtctcattttcttctgttatgcactggcc
ttctggtatggttccacacttgtcctagatgaagaagagtatacaccagggacactggtc
cagattttcctctgtgtcatattagcagctatgaatattggccatgcatcttcttgcttg
gaaatcttctccactgggtgttcagcagctaccaatatttttcaaacaatagacaggcaa
cctgtcattgactgcatgtcaggagacggctacaagctagaccgaatcaagggtgaaatt
gagttccacaatgtgaccttccattatccttctagaccggacgtgaagattttagataac
ctcagcatggtcataaagccaggggaaacgacggctctggtgggatccagtggggctggg
aagagtacagcattacagctcattcagagattctatgacccctgtgaaggcatggtgact
ctggacggccatgacattcgctctcttaacatccggtggctgagagatcaaatcgggatc
gtggaacaggagcccgttctgttctccaccactatcgcagaaaacatccgttttggcaga
gaagatgcaacaatggaagacatagtccaagctgccaaggatgctaatgcatacaacttc
attatggccctgccgcagcaatttgacacccttgttggagaaggaggaggccagatgagt
ggtggtcagaagcaaagagtagccattgcccgagccctcatacggaatcccaagatcttg
cttctggatatggctacctcagcactggacaatgagagtgaagctagagtacaagaagca
ttgaataagatccaacatgggcatacaatcatctcagttgcccatcgcctgtcaacagtc
agagctgcagatgtgatcattgggtttgagcatggagtagctgtggaaagaggcacccat
gaagagctgctagaaagaaaaggtgtctacttcatgcttgtgaccctgcaaagccaagga
gataatgctcacaaagaaacgagcataatggggaaagatgcgacggaaggtggcaccctt
gagaggaccttttccagaggcagctatcgggatagtttaagagcttcgatccggcaacgc
tccaagtctcagctgtctcttctgacacatgaccctccactggctgttgctgatcacaaa
tcctcttacaaagacagcaaggacaatgacgtgcttgtggaagaagttgaacctgcccca
gttaggaggattctaaaatacaacattccagaatggcactacattctggtaggatctttg
agtgcagccattaatggggcagtcacacccatctactcccttttattcagccagctcctt
gggactttttcactcctcgataaagaacaacaaaggtcagagattcacagcatgtgtctg
ttctttgtcatcctgggctgtgtatccattttcacacaatttctgcagggttacactttt
gccaaatccggagagctcctcacaaagaggctgcggaaatttggtttcaaggcaatgtta
ggacaagatatcggctggttcgatgacctcagaaataatcctggagtactgacgactagg
cttgctacagatgcttcccaagttcaaggggctactggctctcaagttggaatgatggtc
aattccttcactaacatcattgcggccttgctgattgccttcttctttagctggaagctc
agtctgattataacgatcttcttcccctttctggctttatcgggagctgtacagacaaaa
atgttgacgggattcgcttctcaagacaagcaagctctggagaaggctggtcagatcacc
agcgaagccctcagcaatatccgcacagttgctgggattggagtggagggaagatttatt
aaagcatttgaggttgagctccagacatcatacaagactgctgtcaggaaggcgaatatc
tatggactctgctttgccttttcccaggggatagcatttcttgcaaattccgctgcctat
agatatggaggttacttaatagcctacgaaggtctgggcttcagccacgttttcagggtg
gtctcttcagttgcattgagtgcaacagccgttggaagaacattctcttatactccgagc
tatgccaaagctaaaatatcagctgcacgcttttttcaactgctagatcggaaacctcca
attaatgtgtacagtgaagcaggtgaaaaatgggacaacttccaagggaagattgatttt
attgactgtaaatttacgtatccttctcgacccgatattcaagttctgaatggtctctca
gtatctgttaatcctgggcagacgctggcatttgttggaagcagtgggtgtggcaaaagc
accagcattcagctgttggaacggttctatgatcccgatcagggaactgtgatgatagat
ggtcatgacagcaaaaaagtcaacattcagttcctccgttccaacatcgggattgtctcc
caggagccagtgctgtttgactgtagcataatggacaacatcaagtacggggacaacact
aaagagatctccgtggagagagccatagctgctgcaaagcaggctcagctgcatgacttc
gtcatgtcgctcccagagaaatatgaaactaatgttgggatccagggctctcagctctct
cgtggagagaaacaacgcattgctattgctcgggccattgtgcgagatcctaaaatctta
ctactggatgaagctacgtctgccctagacacagaaagtgaaaagacagtgcagactgct
ctggacaaagccagagagggtcggacctgcattgtcattgctcatcgtttgtccaccatc
cagaactcagatatcattgctgtcgtgtcacaaggagtggtgattgaaaaagggacccat
gagaaactgatggcccagaagggagcctactacaagctggtcatcactggagcccccatc
agttga

DBGET integrated database retrieval system