KEGG   Rattus norvegicus (rat): 83576
Entry
83576             CDS       T01003                                 

Gene name
Sort1
Definition
(RefSeq) sortilin precursor
  KO
K12388  sortilin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04722  Neurotrophin signaling pathway
rno04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    83576 (Sort1)
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    83576 (Sort1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    83576 (Sort1)
SSDB
Motif
Pfam: Sortilin-Vps10 Sortilin_C BNR_6 BNR
Other DBs
NCBI-GeneID: 83576
NCBI-ProteinID: NP_113955
RGD: 619999
Ensembl: ENSRNOG00000031814
UniProt: O54861
Position
2
AA seq 825 aa
MERPRGAADGLLRWPLGLLLLLQLLPPAAVGQDRLDAPPPPAPPLLRWAGPVGVSWGLRA
AAPGGPVPRAGRWRRGAPAEDQDCGRLPDFIAKLTNNTHQHVFDDLSGSVSLSWVGDSTG
VILVLTTFQVPLVIVSFGQSKLYRSEDYGKNFKDITNLINNTFIRTEFGMAIGPENSGKV
ILTAEVSGGSRGGRVFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVS
KNFGEKWEEIHKAVCLAKWGPNNIIFFTTHVNGSCKADLGALELWRTSDLGKTFKTIGVK
IYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVF
MHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSTLSED
NSIQSMITFDQGGRWEHLQKPENSKCDATAKNKNECSLHIHASYSISQKLNVPMAPLSEP
NAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWAKMLEGPHYYTILDSGGIIVAIEHSNR
PINVIKFSTDEGQCWQSYVFSQEPVYFTGLASEPGARSMNISIWGFTESFLTRQWVSYTI
DFKDILERNCEENDYTTWLAHSTDPGDYKDGCILGYKEQFLRLRKSSVCQNGRDYVVAKQ
PSICPCSLEDFLCDFGYFRPENASECVEQPELKGHELEFCLYGKEEHLTTNGYRKIPGDR
CQGGMNPAREVKDLKKKCTSNFLNPKKQNSKSSSVPIILAIVGLMLVTVVAGVLIVKKYV
CGGRFLVHRYSVLQQHAEADGVEALDTASHAKSGYHDDSDEDLLE
NT seq 2478 nt   +upstreamnt  +downstreamnt
atggagcggccccggggagctgcggacggccttttgcgctggccccttggcctcctcctg
ctcctgcagctgctgccgccagccgccgtcggccaggaccggctggacgcgccgccgcct
cccgcgcctcctctgctgcgctgggccggtccggtcggggtgagctgggggctgcgcgcc
gccgcgcccgggggccctgtcccccgcgctggccgttggcgccgcggcgcgcctgcagag
gatcaggactgcggccgcctcccggacttcatcgccaagctgaccaacaatacgcaccag
catgtctttgatgacctcagtggctcagtgtccttgtcctgggttggagacagcactggg
gttattctcgtcctgactactttccaagtgccactggtaattgtgagttttggacagtcc
aagttatatcgcagtgaggattacggaaagaattttaaggacattacgaatctcatcaat
aacaccttcattcggacggagttcggcatggctattggtcccgagaactctggaaaggtg
atattaacagcagaggtgtctgggggaagccgaggaggaagagtgttcaggtcatcagac
tttgccaagaactttgtacagacagacctcccctttcatcctctgactcagatgatgtac
agccctcagaattctgattacctgttagctctcagcactgaaaatggcctgtgggtgtcc
aagaattttggggaaaaatgggaagaaatccacaaagcagtatgtttggccaaatgggga
ccaaacaacatcatcttctttaccacccatgtgaatggctcctgcaaagctgatcttggt
gccctggaattatggagaacatccgacttggggaaaaccttcaaaaccattggtgtgaaa
atctactcatttggtcttgggggccgtttcctcttcgcctctgtgatggctgataaggat
acaacaagaaggatccacgtgtcaacagaccaaggggacacatggagcatggcacagctt
ccctctgtgggacaggagcaattctattctattctggcagccaacgatgacatggtgttc
atgcatgtagatgaacctggagatactggatttggtacaatctttacctctgatgaccga
ggcattgtctactctaagtctctggacagacatctctataccaccacaggcggggagacc
gactttaccaacgtgacttccctccgtggagtctatataacaagcacactctcagaagat
aattccattcagagcatgatcacttttgaccagggaggacggtgggagcatctgcagaag
ccggagaacagcaagtgcgatgctaccgcaaagaacaagaatgagtgcagccttcatatc
catgcttcttacagcatctcccagaagctaaatgttccaatggccccactctccgagccc
aatgccgtgggcatagtcatcgctcacggtagtgtgggagacgccatctcggtgatggtc
ccagacgtgtacatctcagatgatgggggttactcttgggcaaagatgctagaaggaccg
cattattataccatcctggactctggaggcatcatcgtggccattgaacacagcaaccgt
cctatcaatgtgattaagttctccacagacgaaggccagtgctggcagagctatgtgttc
agtcaggagcccgtctacttcaccgggctggcttccgagccgggagccaggtccatgaac
atcagcatctggggattcacggagtctttccttacccgccagtgggtctcctacacaatt
gatttcaaagacatccttgagcgcaactgtgaagagaatgactataccacatggctggca
cactccactgaccccggagattacaaagatggctgcattttgggctataaagagcagttc
ctacggctacggaagtcatccgtctgtcagaatggtcgagactatgttgtggccaagcag
ccatccatctgtccctgttccctggaggacttcctctgtgactttggctacttccgtcca
gagaatgcctcagagtgtgtggagcagccggaactgaagggtcatgagttagagttctgt
ctgtatggcaaagaggagcacctgaccacaaatgggtaccggaaaatcccaggagacaga
tgccaagggggaatgaatccggcccgagaagtaaaagacttgaagaagaaatgcacaagc
aacttcttaaaccccaagaagcagaattccaagtcgagttctgtccctatcatcctggcc
atcgtgggactgatgcttgtcactgtcgtagcaggagtcctcattgtgaagaagtatgtc
tgtggcggaaggttcctggtgcaccggtactcggtgcttcagcagcacgcagaggctgac
ggggtggaggctttggatacggcctcccacgctaaaagcggttatcacgatgattcagac
gaggacctcctggaatag

DBGET integrated database retrieval system