KEGG   Rattus norvegicus (rat): 83581
Entry
83581             CDS       T01003                                 

Gene name
Polr1a
Definition
(RefSeq) DNA-directed RNA polymerase I subunit RPA1
  KO
K02999  DNA-directed RNA polymerase I subunit RPA1 [EC:2.7.7.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    83581 (Polr1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    83581 (Polr1a)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     83581 (Polr1a)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Core subunits
     83581 (Polr1a)
SSDB
Motif
Pfam: RNA_pol_Rpb1_5 RNA_pol_Rpb1_2 RNA_pol_Rpb1_3 RNA_pol_Rpb1_4 RNA_pol_Rpb1_1
Other DBs
NCBI-GeneID: 83581
NCBI-ProteinID: NP_113960
RGD: 620824
Ensembl: ENSRNOG00000009545
UniProt: O54889
Position
4
AA seq 1716 aa
MLASKHTPWRRLQGISFGMYSAEELKKLSVKSITNPRYVDSLGNPSADGLYDLALGPADS
KEVCSTCVQDFNNCSGHLGHIDLPLTVYNPLLFDKLYLLLRGSCLNCHMLTCPRAAIHLL
VCQLKVLDVGALQAVYELERILSRFLEETSDPSAFEIQEELEEYTSKILQNNLLGSQGAH
VKNVCESRSKLVAHFWKTHMAAKRCPHCKTGRSVVRKEHNSKLTITYPAMVHKKSGQKDA
ELPEGAPAAPGIDEAQMGKRGYLTPSSAQEHLFAIWKNEGFFLNYLFSGLDDIGPESSFN
PSMFFLDFIVVPPSRYRPINRLGDQMFTNGQTVNLQAVMKDAVLIRKLLAVMAQEQKLPC
EMTEITIDKENDSSGAIDRSFLSLLPGQSLTDKLYNIWIRLQSHVNIVFDSDMDKLMLEK
YPGIRQILEKKEGLFRKHMMGKRVDYAARSVICPDMYINTNEIGIPMVFATKLTYPQPVT
PWNVQELRQAVINGPNVHPGASMVINEDGSRTALSAVDATQREAVAKQLLTPSTGIPKPQ
GAKVVCRHVKNGDILLLNRQPTLHRPSIQAHRAHILPEEKVLRLHYANCKAYNADFDGDE
MNAHFPQSELGRAEAYVLACTDQQYLVPKDGQPLAGLIQDHMVSGANMTIRGCFFTREQY
MELVYRGLTDKVGRVKLFPPAILKPFPLWTGKQVVSTLLINIIPEDYTPLNLTGKAKIGS
KAWVKEKPRPVPDFDPDSMCESQVIIREGELLCGVLDKAHYGSSAYGLVHCCYEIYGGET
SGRVLTCLARLFTAYLQLYRGFTLGVEDILVKPNADVMRQRIIEESTQCGPRAVRAALNL
PEAASCDEIQGKWQDAHLGKDQRDFNMIDMKFKEEVNHYSNEINKACMPFGLHRQFPENN
LQMMVQSGAKGSTVNTMQISCLLGQIELEGRRPPLMASGKSLPCFEPYEFTPRAGGFVTG
RFLTGIRPPEFFFHCMAGREGLVDTAVKTSRSGYLQRCIIKHLEGLVIQYDLTVRDSDGS
VVQFLYGEDGLDIPKTQFLQPKQFPFLASNYEVIMKSKHLHEVLSRADPQKVLRHFRAIK
KWHHRHSSALLRKGAFLSFSQKIQAAVKALNLEGKTQNGRSPETQQMLQMWHELDEQSRR
KYQKRAAPCPDPSLSVWRPDIHFASVSETFEKKIDDYSQEWAAQAEKSHNRSELSLDRLR
TLLQLKWQRSLCDPGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILM
VASANIKTPMMSVPVFNTKKALRRVKSLKKQLTRVCLGEVLQKVDIQESFCMGEKQNKFR
VYELRFQFLPHAYYQQEKCLRPEDILHFMETRFFKLLMEAIKKKNSKASAFRSVNTRRAT
QKDLDDTEDSGRNRREEERDEEEEGNIVDAEAEEGDADASDTKRKEKQEEEVDYESEEEG
EEEEEEDVQEEENIKGEGAHQTHEPDEEEGSGLEEESSQNPPRRHSRPQGAEAMERRIQA
VRESHSFIEDYQYDTEESLWCQVTVKLPLMKINFDMSSLVVSLAHNAIVYTTKGITRCLL
NETINSKNEKEFVLNTEGINLPELFKYSEVLDLRRLYSNDIHAVANTYGIEAALRVIEKE
IKDVFAVYGIAVDPRHLSLVADYMCFEGVYKPLNRFGIQSSSSPLQQMTFETSFQFLKQA
TMMGSHDELKSPSACLVVGKVVKGGTGLFELKQPLR
NT seq 5151 nt   +upstreamnt  +downstreamnt
atgctggcctccaagcacacgccatggcggcggcttcagggcatttccttcgggatgtat
tcggccgaggagctcaagaagttaagtgttaagtccattacaaatcctcgctatgtggac
agcctgggaaacccttcggcagatggcctgtatgatttggctttgggtcctgcagattcc
aaagaagtatgctctacctgtgtgcaggacttcaacaactgctccggacacctgggccac
attgacctcccgctcacagtgtacaaccctctcctcttcgataaactctacctgctgctg
cgaggctcctgtttaaattgtcatatgctgacttgtcctcgggctgcaattcacctattg
gtctgccagctgaaggtcctagacgttggagccctacaagcagtctatgagcttgagcgg
attctcagcaggtttctggaagaaacttcggatccttctgccttcgaaattcaagaagag
ttagaagagtacacaagcaaaattctgcagaataacctcctggggtcccagggtgcacat
gtgaaaaatgtgtgcgagagcagaagcaaacttgtcgctcacttctggaagacacacatg
gctgctaagcgctgtccacactgcaagacgggacggtcagtggttcgaaaggagcacaat
agtaagctaacaataacatatccagccatggtgcacaagaagtctggccagaaggatgca
gaactcccagaaggagcaccagcagctccaggaattgatgaggctcagatggggaaacga
ggatacttgaccccaagcagcgcccaagaacatcttttcgccatttggaagaatgaagga
ttcttcctgaattatcttttttcgggattggatgatattggcccagagtccagtttcaac
cccagtatgttctttctagatttcatcgtggtaccgccatccaggtatcgtcccatcaat
cgcctgggtgaccagatgttcactaatggccagacagtgaatttgcaagcggtcatgaag
gatgcagttttgatccggaaacttctggcagtgatggcccaagaacagaaactgccctgt
gagatgacagaaatcaccatagacaaggaaaatgactcctcgggtgctatcgaccggtcc
tttctgagtttgcttccaggacagtctctcacagataaactttacaatatttggattcgc
ctccagagccacgtcaatattgtgtttgacagtgacatggacaaactgatgctggaaaag
taccctggcataagacagatcctcgagaagaaggaaggcctgttccggaagcacatgatg
ggaaagcgagtggactacgcagcccgctcggtcatctgcccagatatgtacatcaacacc
aatgagatcgggattcccatggtatttgccacaaaactgacttacccccagccagttacc
ccctggaacgtgcaggaactgagacaggcagtcatcaatggacccaatgtgcacccagga
gcctccatggtcatcaacgaggatggcagtcgcacagccctgagcgcagtggatgctaca
cagcgggaagctgtggccaaacagctcctgacaccgtccacagggatccctaagcctcag
ggagcaaaagttgtgtgccggcatgtgaagaatggggacattctcctcctgaaccgacag
cccaccttgcacagaccctccatccaggcccaccgtgcccacattctgcctgaggaaaaa
gtcctgcgccttcactatgccaactgcaaggcctacaatgctgacttcgatggagacgag
atgaatgcccacttcccccagagtgagctgggccgagctgaagcctatgtcctggcctgc
actgaccagcagtatcttgttcccaaggatggccagcccttggcaggactgattcaggat
cacatggtgtcgggtgcaaacatgaccattcggggatgctttttcacccgggaacagtac
atggagctggtgtaccgagggctcacagacaaagtgggacgcgtgaagctctttcctcct
gccatcctgaagcccttcccgctgtggacaggaaagcaggtcgtgtcgaccctcctcata
aacataatcccagaggactacacccccctgaatttaactggaaaggcaaaaatcggcagt
aaagcctgggtgaaggaaaagcctcggcctgttcctgactttgaccctgactccatgtgt
gagtcccaggtgatcatcagggaaggggagctgctctgcggggtgctggacaaggcacac
tatgggagctctgcctacggcctggtccactgctgctacgagatctatgggggtgagacc
agcggcagggttctcacctgcttagcccgcctcttcactgcctacctacagctctatcga
ggtttcaccttgggtgtggaagacattttggttaagccaaatgcagatgtgatgagacag
cgcatcattgaagaatctacccagtgtggaccccgggctgtcagggctgcgttgaacctg
ccagaggctgcatcatgtgatgagatccaggggaaatggcaggatgcccatctgggcaaa
gaccagagggattttaacatgattgatatgaagttcaaggaggaagtgaaccattacagc
aatgagattaacaaggcatgtatgccttttggcttgcacagacaattccctgaaaacaac
ctgcagatgatggtgcagtcgggagccaaagggtcgaccgtgaacacgatgcaaatctct
tgcctgctgggccaaattgagttggaaggtcggagacccccactgatggcgtctggcaag
tcactgccctgctttgagccttacgagttcaccccaagggctggtggctttgtcactgga
aggttccttaccggtatcaggccacctgagttcttcttccactgcatggcggggcgagaa
ggcctggtggatactgctgtcaagaccagccgttctggctatctccaaaggtgtatcatc
aagcacctggagggtctggtcatccagtacgatctcacggtccgtgacagtgatggcagt
gtggtacagttcctgtatggggaggatggcctggacatccccaagacacagttcctacaa
cccaagcagttcccctttctggccagcaattatgaggtgataatgaaatccaagcatctt
catgaagttttgtctagagcagatccccagaaagtgctccgccacttcagagccattaaa
aaatggcaccacaggcattccagtgccctgctgagaaaaggcgccttcctgagtttttcc
cagaagattcaggcagctgtgaaagccttgaacctagagggcaagacccagaatgggcgc
agcccagagacccagcagatgttacagatgtggcatgaattagatgagcagagccgacgg
aaataccagaagagggctgccccgtgtcccgaccctagcctttctgtgtggcgcccagac
atccacttcgcatctgtgtctgaaacatttgaaaaaaagattgatgactacagtcaggag
tgggcagctcaagcagagaagagtcacaacagatcagagctttctcttgacaggctgaga
accttactgcagctcaagtggcagcgctcactgtgtgacccaggcgaggctgttggcctc
ctggccgcccagagcatcggagagccctccacacagatgacactgaacaccttccacttt
gcaggcagaggcgagatgaacgtcaccctgggcattccaagattgagggagattctcatg
gtggccagtgccaacatcaaaacacccatgatgagcgtgcctgtgttcaacaccaagaaa
gcactgaggagagtgaagagtctgaagaagcagctcaccagggtgtgcctgggggaggta
ttgcagaaagttgacatccaggagtccttctgtatgggagagaaacagaataaattccgg
gtgtatgagctccggtttcagttcctgccacatgcatattaccagcaggagaagtgcctg
agacccgaggacatcttgcacttcatggaaaccagattctttaagctactaatggaagct
atcaaaaagaagaatagcaaagcatcagccttcagaagtgtgaataccaggagagctaca
cagaaggacctcgatgacactgaggactcggggaggaatcggagagaggaggaaagggat
gaggaagaggaggggaacattgtggatgctgaagctgaggagggggatgcagatgcttct
gacaccaaacgcaaggagaagcaagaagaagaggttgactatgagagtgaggaagaaggg
gaggaggaagaggaagaggatgtacaagaagaggagaacatcaaaggtgaaggtgcccac
cagacccatgagccagatgaggaagaaggttcaggccttgaggaggaatcatcccagaac
cctccccgccgccattccaggcctcagggagctgaggccatggaacgccgaatccaggct
gtacgggagtcccattcgttcattgaggactaccagtatgacacagaggagagcctgtgg
tgccaggtgacagtgaagctcccattgatgaagattaattttgacatgagctccttggtt
gtatccttggcccacaatgccattgtctatacgactaagggcatcactcggtgtctcctg
aatgaaacgatcaacagtaagaatgagaaggagtttgtcctgaacacggagggaatcaac
ctccccgagctgttcaagtactccgaggtgctggacctgcgccgcctgtactccaacgac
atccatgctgtggccaatacgtacggcatcgaggctgcgctgcgggtgatagagaaggag
attaaggatgtgtttgctgtgtacggcattgcggttgatcctcgccatctctccctggtt
gctgattatatgtgttttgagggtgtttataagccactcaatcgctttgggatccagtca
agctcctcccctttgcagcagatgacgtttgaaaccagcttccagtttctgaaacaggcc
accatgatgggatcccatgatgaactgaagtcaccttctgcctgccttgtggtgggaaag
gtcgtcaaaggcgggacaggcctgtttgagctcaagcagcccctaagatag

DBGET integrated database retrieval system