KEGG   Rattus norvegicus (rat): 83582
Entry
83582             CDS       T01003                                 

Gene name
Polr1b
Definition
(RefSeq) DNA-directed RNA polymerase I subunit RPA2
  KO
K03002  DNA-directed RNA polymerase I subunit RPA2 [EC:2.7.7.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    83582 (Polr1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    83582 (Polr1b)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     83582 (Polr1b)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Core subunits
     83582 (Polr1b)
SSDB
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_1 RNA_pol_Rpb2_3 RNA_pol_Rpb2_7 RNA_pol_Rpa2_4 RNA_pol_Rpb2_2
Other DBs
NCBI-GeneID: 83582
NCBI-ProteinID: NP_113961
RGD: 620822
Ensembl: ENSRNOG00000018349
UniProt: O54888
Position
3
AA seq 1135 aa
MDVDSRWRNLPSGPSLKHLTDPSYAVPPEQQKAALQDLTRAHVDSFNYAVLEGLSHAVQA
IPPFEFAFKDERISLTIVDAAISPPAVPKGTICKELNIYPAECRGRRSTYRGKLTADISW
AVNGVPKGIIKQFLGYVPIMVKSKLCNLYNLPPQVLIEHHEEAEEMGGYFIINGIEKVIR
MLIMPRRNFPIAMIRPKWKSRGLGYTQFGVSIHCVREEHSAVNMNLHYVENGTVMLNFIY
RKELFFLPLGFALKALVSFSDYQIFQELIKGKEEDSFFKNSVSQMLRIVMEEGCHTQKQV
LDYLGERFRVKLSLPDWYPNAEAAEFLFNQCICIHLKSNTDKFYLLCLMTRKLFALARGE
CMEDNPDSLVNQEVLTPGQLFLMFLKEKMENWLLSIKIALDKRAQKTNVSINNENLMKIF
SMGTELTRPFEYLLATGNLRSKTGLGFMQDSGLCVVADKLNFIRYLSHFRCVHRGADFAK
MRTTTVRKLLPESWGFLCPVHTPDGAPCGLLNHLTAVCEVVTKFVYTASIPALLCGLGVT
PVDAAPCRPYSDCYPVLLDGVMVGWVDKELAPEVADTLRRFKVLRERRVPPWMEVALIPM
TGKPSLYPGLFLFTTPCRLVRPVQNLELGKEELVGTMEQLFMNIAIFEDEVFGGVSTHQE
LFPHSLLSVIANFIPFSDHNQSPRNMYQCQMGKQTMGFPLLTYQDRSDNKLYRLQTPQSP
LVRPCMYDHYDMDNYPIGTNAIVAVISYTGYDMEDAMIVNKASWERGFAHGSVYKSEFID
LSEKFKQGDDSLVFGVKPGDPRVMQKLDNDGLPFIGAKLEFGDPYYGYLNLNTGEGFVVY
YKSKENCVVDNIKVCSNDTGSGKFKCVCVTVRVPRNPTIGDKFASRHGQKGILSRLWPAE
DMPFTESGMMPDILFNPHGFPSRMTIGMLIESMAGKSAALHGLCHDATPFIFSEENSALE
YFGEMLKAAGYNFYGTERLYSGISGMELEADIFIGVVYYQRLRHMVSDKFQVRTTGARDK
VTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHDRLFNCSDRSVAHVCVKCGSLLSPL
LEKPPPSWSAMRNRKYNCTVCGRSDSIDTVSVPYVFRYFVAELAAMNIKVKLDVI
NT seq 3408 nt   +upstreamnt  +downstreamnt
atggatgtcgacagccggtggcggaacctgcccagcgggcccagcctaaagcatttaacc
gacccctcgtacgcggttcctccggagcagcaaaaggcggcgttgcaggacctgacgcgg
gcgcacgtggactccttcaactacgcagtgctggaggggctgagccacgcggtgcaggcc
atacctcccttcgaatttgctttcaaagatgagcgcatatctcttactattgtggacgct
gccatcagtccacccgcagtgcccaaagggaccatctgcaaagagctcaacatttatcca
gctgagtgccgtggccggaggagcacgtaccgagggaagctgacggctgatatcagctgg
gccgtgaatggagtccccaaaggcatcattaaacaatttcttggctatgttcccatcatg
gtgaagtccaagctttgcaacttatacaaccttcctcctcaagtcctcattgagcaccac
gaggaggcagaggaaatgggcggttattttataatcaacggcattgagaaagtcatccgc
atgttgattatgcctcggagaaattttcccatcgcaatgataagaccgaaatggaaaagc
agagggctcggctacactcagttcggggtttccattcactgtgtgagagaggagcactct
gctgtcaatatgaaccttcactatgtggagaacggcacggtcatgttaaactttatttac
cgcaaagagctgtttttccttcctttgggatttgcacttaaggcacttgtgagcttttct
gactatcagattttccaggagctcatcaaaggcaaagaggaggactctttctttaagaat
tctgtttctcagatgctgaggattgtaatggaggagggttgtcacacacagaagcaggtc
ctcgactatctgggcgaacgcttcagagtaaagctcagtcttcccgattggtaccctaat
gcggaagctgccgagttcctgtttaaccagtgcatctgcatccacttgaaatccaacact
gacaagttttacctgctctgtctcatgacccggaagctctttgctttagccagaggagag
tgcatggaggacaatcctgacagtttagtgaatcaagaagtccttacccctgggcagctc
ttcctgatgtttctgaaggaaaagatggagaattggctactgtctattaaaatagcttta
gataaaagggctcagaagaccaatgtttccataaacaatgaaaatttgatgaagattttt
agtatgggaacagagctaacaagaccatttgaatatcttcttgctactggaaatctgcgt
tctaaaacaggtcttggcttcatgcaggattctggcctgtgtgttgtggctgacaagctg
aacttcattcgctatctctcccatttccgctgtgtgcacagaggggctgactttgccaag
atgaggaccaccaccgtgcgcaagctgctgccagaatcctggggcttcctctgccctgtg
cacaccccagacggggcaccgtgtgggctgctgaaccacctgactgctgtgtgtgaggtt
gttaccaagtttgtgtacacagcatctattccagccttgctctgtggcttaggagtcact
cctgttgatgcagcaccatgtcgaccgtatagtgactgctaccctgtcctgctggatggc
gtcatggtgggctgggtggataaggagctggctcctgaagtggcagacactctccgtcga
tttaaggtgttgagagaaaggagagttcctccctggatggaggtggccctgattcccatg
acaggaaagccaagcctgtacccagggctgttcctcttcaccactccctgcaggctggtg
aggcctgtgcagaacctggagctgggcaaagaagagctcgttggaactatggagcagctc
ttcatgaacattgccatcttcgaggacgaggtttttggtggagtttccacacaccaggag
ctcttccctcacagcctgctgagcgtgatagccaacttcatccccttctctgatcacaac
cagagtcctcggaacatgtaccagtgccagatgggtaagcagaccatgggcttcccgctg
ctcacctaccaagaccgatcagataataaactctatcgtctccagacaccccagagccct
ctagtgagaccgtgcatgtatgatcattatgacatggacaactatcccatcgggacaaac
gccattgtggctgtgatctcctacactggctatgatatggaggacgccatgattgtaaac
aaggcctcctgggaacgaggctttgctcatggaagtgtctacaagtctgagttcatagac
ctctctgagaaatttaagcaaggggatgatagtctggtatttggggtcaaacctggtgac
ccacgggttatgcagaagctggacaatgatggcttgccattcataggagcaaagctggag
tttggtgatccttactacggctacctaaaccttaacaccggagaaggcttcgtggtttac
tataagagtaaagaaaactgtgttgtggacaacatcaaagtgtgcagtaatgacacagga
agtgggaagttcaagtgcgtctgcgtcaccgtccgagtcccccggaacccaactattgga
gataagtttgccagccgccacggacagaagggcattttgagcagattgtggccagctgag
gacatgcctttcacagagagtgggatgatgccggacattctgtttaatcctcatgggttt
ccctcccgtatgaccataggtatgttaatcgagagtatggctgggaagtcagcagctttg
catggtctctgccatgatgcaacacccttcatcttctccgaggagaactctgccctagag
tactttggtgagatgttaaaggctgccggctacaacttctatggcacggagagattgtac
agcggcatcagcgggatggagctggaggctgacattttcattggtgtggtttattaccag
cgcctacgacacatggtgtcagacaaatttcaagtcagaacaactggagccagggacaaa
gtcaccaaccagcccatcggaggcaggaacgtccagggtgggatccgatttggggagatg
gagcgggatgctctgttggcgcacggcacatctttccttctgcatgaccgcctcttcaac
tgctccgaccgctctgtggcccacgtatgcgtgaagtgtggcagtttgctttctccgctg
ctcgagaagcctcccccatcttggtctgcgatgcgtaacagaaaatacaactgcaccgtc
tgtggccgcagtgactccatcgacactgtctctgtgccgtatgttttccggtactttgta
gctgagctggctgccatgaacatcaaagtgaaactggacgtcatttaa

DBGET integrated database retrieval system