KEGG   Rattus norvegicus (rat): 83586Help
Entry
83586             CDS       T01003                                 

Gene name
Usf1
Definition
(RefSeq) upstream transcription factor 1
  KO
K09106  upstream stimulatory factor
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    83586 (Usf1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    83586 (Usf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH Rootletin
Motif
Other DBs
NCBI-GeneID: 83586
NCBI-ProteinID: NP_113965
RGD: 620974
Ensembl: ENSRNOG00000004255
UniProt: O35410
Position
13q24
AA seq 310 aa AA seqDB search
MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVM
YRVIQVSEGQLDGQTEGSGAISGYPATQSMTQAVIQGAFTSDDAVDAEGTAAETHYTYFP
STAVGDGSGGTTSGSTTAVVTTQGSEALLGQATPPSTGQFFVMMSPQEVLQGGSQRSIAP
RTHPYSPKSEAPRTTRDEKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKSGQSK
GGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLRHHG
LEVVIKNDSN
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggcagcagaaaacagccgaaaccgaagaggggacagtgcagattcaggaaggt
gcagtggctactggagaggacccaactagtgtagctatcgccagcatccaatcagctgcc
actttccccgaccccaacgtcaagtacgtcttccgaactgagaatgggggccaggtgatg
tacagggtgatccaggtgtctgaggggcagctggatggccagacagagggctctggcgct
atcagtggctaccctgccactcagtctatgactcaggcagtaatccagggggctttcacc
agtgatgatgctgttgacgcggagggaacagctgccgagacccactacacttacttcccc
agcaccgcagtgggagatgggtcagggggtacgacatctgggagtacaaccgccgtggtc
accacccagggctcagaggcactgctggggcaggcaaccccgcccagcacaggccaattc
tttgtgatgatgtcaccacaagaagtgttacagggagggagccagcggtcaattgccccc
aggacccacccttattccccgaagtcagaggctcccaggacaacgcgagatgagaaacgg
agggctcaacataacgaagtggagcgccgccgccgggacaagatcaacaactggattgta
cagctgtccaaaatcatcccagactgctctatggagagcaccaagtctggccagagtaag
ggtggaatcctgtccaaagcctgtgactatatccaggaactacgtcagagcaaccaccgg
ctgtctgaagagctgcaggggttagatcagttgcagctcgacaatgacgtgcttcgacag
caggtggaagatcttaaaaacaagaacctgctactacgagctcagttacggcaccacgga
ttagaggtcgtcatcaagaatgacagcaactaa

DBGET integrated database retrieval system